(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE533

PENCW_13.PE533       Location/Qualifiers
FT   CDS_pept        join(1250786..1250933,1251016..1251179,1251245..1251348,
FT                   1251409..1251853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948817"
FT                   /orf_name="Pc16g05330"
FT                   /product="Pc16g05330 protein"
FT                   /protein_id="CAP93203.1"
FT                   /db_xref="UniParc:UPI0001831C0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I6"
FT                   /transl_table=1
FT                   /translation="MLTQLQQESMQSGRAIAGILPSPRVDQEKSCRTVPMRVLVLGLSR
FT                   TGTESLIQLGYDGTYHGYTAAVESPRDCKTWLRAMRAKFDGVGAPFVREDWDQLLGHYQ
FT                   AVCDVPAACFADELMTAYPNAKVILTNRDTDEWFYSVSKTLVANAFTRKASLISLFATI
FT                   TRSPNRWTRPTMMYALSDFFDGDFERNGKQTYREHYRRVREMARERKMELLDYEIKDGW
FT                   EPLCKFLGHDVPVGPFPCGNDKQEVNARIKAIINREIQRLLLIFAFLFSCFAFTGLATI
FT                   TLVGI"
     atgctcaccc agcttcaaca ggaatccatg cagtccggac gggcgatagc gggaatctta        60
     ccttcgcccc gtgtcgacca ggagaaatcc tgccgtaccg ttccaatgcg ggttctcgta       120
     ctagggctaa gtcgaactgg aacggaatcc ttgatacaat tgggttacga cggaacatac       180
     catggctata cggcagccgt ggagagcccg cgggattgta agacatggct acgggcaatg       240
     cgggctaagt ttgacggcgt gggagcaccg ttcgtccggg aggactggga tcagctgctc       300
     gggcactacc aagcagtgtg tgacgttcca gcggcatgct tcgcagatga attaatgaca       360
     gcatacccga acgcgaaagt catcttgaca aaccgtgaca ccgatgaatg gttctattca       420
     gtctcaaaga cactcgttgc aaatgcgttc acgcgaaagg cttctttaat ttccctattt       480
     gccacgataa cgcgcagtcc aaaccggtgg accagaccaa ccatgatgta tgccctgtct       540
     gacttttttg atggcgactt cgagcggaat ggaaagcaaa cctatcggga gcactatcgg       600
     cgggtgcggg agatggctcg cgagaggaaa atggaattgc ttgactatga gattaaagac       660
     gggtgggaac cactttgtaa gttcctaggt cacgacgtgc cagtgggccc atttccttgt       720
     ggcaatgata agcaggaggt aaatgccagg atcaaggcaa tcataaatcg ggagatccaa       780
     aggcttctac tcatatttgc ttttctattc tcttgttttg catttactgg tttggccacc       840
     atcacgttag tcggtatata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page