(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE534

PENCW_13.PE534       Location/Qualifiers
FT   CDS_pept        join(1252945..1252985,1253035..1253422,1253484..1254002)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948818"
FT                   /orf_name="Pc16g05340"
FT                   /product="Pc16g05340 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="carotenoid biosynthetic process "
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="CAP93204.1"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0016117"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="UniParc:UPI0001831C0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I7"
FT                   /transl_table=1
FT                   /translation="MVWLDEENPNNLNSYFFLFWFTTMDGRKYHVTLAPNFFRGRTTGI
FT                   FRVEDLQDLSSTGATVFAPGTGSNEFLDFRSEIQNLTSPRVSDNYTDLNVSTNYAGVQL
FT                   NVHITPTGKNLYIGGGGGITLSSDDNDFRRIIPGYSWYWGNPTLRLNGTITIDGEEIAV
FT                   DHDQSRGYFERQWGEFGISGGHYGYWLYLSNGLMIHGWVVSPTTEQPFGVPAWATVWHP
FT                   NGVHEVVEVGKNTTAFDVWKSEYSGRNYFNQVELDIPSRQARFDIHQLIRESEVRPLSG
FT                   TDGYNISEAYAQGQGVWEGEPVTFFGHLEQLSFW"
     atggtctggc ttgatgagga aaatcccaac aacttgaata gttacttctt cctcttttgg        60
     ttcacgacaa tggacggccg caagtatcat gtaacgttag caccgaattt cttccgtggc       120
     cgcaccactg gtatcttcag ggtagaagac ctccaagatc tctcatcgac gggggctact       180
     gtctttgcac ccggcacggg aagcaatgaa tttcttgact tccgttccga aattcagaac       240
     ttgaccagcc ctcgtgtgtc cgataattat acagacttga atgtctccac aaactatgct       300
     ggggtgcagc ttaatgtaca cattacccca accggcaaaa atctgtacat tggcggaggc       360
     ggcggtatta ctttatcaag cgatgacaat gatttccgca gaatcatacc tggttactcc       420
     tggtactggg gaaaccctac cctacgtcta aatggcacga taactatcga cggcgaagaa       480
     attgcagttg atcacgatca atcccgaggg tactttgagc gccagtgggg agagtttggg       540
     atttctggtg gccattatgg atattggctc tacctctcga atgggttaat gattcacgga       600
     tgggtagtaa gtcctactac ggagcagccc ttcggtgtcc ccgcctgggc aaccgtctgg       660
     catcccaatg gtgttcacga ggttgtggaa gtgggcaaaa acacgacagc attcgatgtt       720
     tggaaaagtg aatatagtgg acggaactat ttcaaccaag tcgagctgga tatacctagt       780
     cgccaggcga gattcgatat ccaccagctg atacgggaaa gtgaggtccg cccactttcc       840
     ggcaccgatg gatataatat cagcgaagca tatgctcaag gacagggtgt ttgggaaggc       900
     gaacctgtca ctttctttgg acacctcgaa cagctttctt tctggtag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page