(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE538

PENCW_13.PE538       Location/Qualifiers
FT   CDS_pept        join(complement(1259270..1259343),
FT                   complement(1257957..1259220),complement(1256973..1257785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824622"
FT                   /orf_name="Pc16g05380"
FT                   /product="Pc16g05380 protein"
FT                   /function="ATP binding"
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93208.1"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831CE0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H878"
FT                   /transl_table=1
FT                   /translation="MACRIPDLVLHGRPSQLPLPQPAAHLQSVAGSTRVFGEFHQGSGS
FT                   VLADDDDDILRFCERAQQVFKAQSARCFVHGFLVRGTTLELWAFDRSGAYSGKRLDLTQ
FT                   RPDLLVRTLAGYALMSDEEVGFNTFVKNAPGSDSYVAFDHRDKLHLRPELIATADYTVG
FT                   PGTTCYVASTSTVGEPDTVIKFSWREDEEPTEVRLLKRAHERNACGVIQVLGYQDLVNI
FT                   ADLRQGLHFPQTFANRTFSCVATTPLGRPIRQFTSIPELLEVLRDLVKALQSLCVNARI
FT                   LHRDVAIKNLIITPQHSANSPRGVLLDFDFALDLDNVRPIEPMVGSDGFMAIGILSGQR
FT                   HTYRHDLESLFYVFLWIAIANDRAHDEANDILEGLPKTSRLWKWCTMDFGAVGRDKAAD
FT                   MSPEGFEEILDEFSSDFAPLRGLAKELHALLFPMCDGKIFTGTETDQNIAHNDNWYPCF
FT                   TGLLSSGGLSQMTWKPGEQNVAETYAGDLKHLRDLLDMHDMPASVCIKLIHIHIHLNKG
FT                   EILVVHELDAPPHGKTPFLEPMAPDVAGKVYGCNYIVDDSGDLQGFEYTTIEGGPDLAA
FT                   YPSFVAEFRAAVVQRGVQHNFALAVNLGAAQRGSWMELDFPEKRATFLLPSHVPLPQSD
FT                   RLVLRTTITKFPSPKNEKNGTKDLPTHGHIEHTWGSSKRIGVDDEEPVDGVTTKNGLHL
FT                   MGVPLEPGTAFYMAVSAISAAV"
     atggcttgcc gaattccaga ccttgttctt cacggtcgac caagccaact tccgcttcca        60
     cagccagccg ctcatctcca gtcagttgca ggcagcaccc gagtgtttgg tgaattccat       120
     caaggcagcg gctccgtctt ggctgacgac gacgacgaca ttctgcgctt ctgcgagcgg       180
     gcacagcagg tgttcaaggc tcagtcggct cgatgctttg tacacgggtt cctggtccgc       240
     ggtactacgc tggagctctg ggcttttgat cggtcggggg cctacagcgg caagaggctt       300
     gacctgacgc agaggcccga cctgctggtg cggactctgg ccggctacgc attgatgagt       360
     gatgaggaag ttgggtttaa cacttttgta aagaacgcac ctggatcgga cagctatgtc       420
     gcatttgacc accgcgataa gctccacctt cgaccagagt tgattgcaac ggcagactat       480
     acagtcgggc caggaacaac ctgctatgtg gcctcgacat cgacagtcgg ggaaccagac       540
     accgtcatca agttttcctg gcgcgaggat gaagagccca ctgaggtccg cctactgaag       600
     cgggcgcacg agcgcaacgc ctgtggcgtc atccaggtcc taggctatca ggacctggtg       660
     aacatcgccg accttcgcca ggggctgcac tttcctcaga cgtttgcgaa ccggacattc       720
     tcgtgcgtcg caaccacccc tctaggccgt ccgatccggc agttcacatc gattcccgag       780
     cttttggagg ttttgcgcga ccttgtcaaa gcccttcaat ccctctgcgt gaatgcgagg       840
     atcctccatc gcgacgtcgc cattaagaat ttgatcatca ccccgcagca cagcgcaaac       900
     agccccaggg gtgtcttgct cgatttcgac ttcgcgctag atctcgacaa cgtccgtcct       960
     attgagccaa tggttggatc agatggcttc atggccattg gcattctctc cggacaacgt      1020
     catacgtatc ggcacgactt ggagtccctg ttctatgtat tcctatggat cgctattgcg      1080
     aacgaccgcg cgcacgacga ggcaaatgac atactggaag gcctaccaaa gacatcacgg      1140
     ctctggaaat ggtgcaccat ggacttcggt gctgtcggac gggataaggc cgccgacatg      1200
     agccctgagg gctttgaaga aattctggac gagttttcct ctgacttcgc tcctctccga      1260
     gggctggcca aagaactgca cgcgctgctc tttcctatgt gcgatggtaa gattttcacc      1320
     ggtactgaga cagaccagaa tatcgcacac aacgacaact ggtatccttg cttcacgggg      1380
     cttttgagct ccggggggct ctcccaaatg acatggaaac ctggagagca gaacgtcgcc      1440
     gagacctacg ccggcgatct caagcacctg agagacctct tggacatgca cgacatgccg      1500
     gcgagtgtct gtatcaaatt gatccacatc cacatccatc tgaacaaagg cgagatcttg      1560
     gttgtgcacg agttggacgc accgccccac ggaaagactc cttttctgga gcccatggca      1620
     cctgacgtgg caggaaaggt ctacggctgc aactacattg tggatgactc gggcgatctc      1680
     caggggttcg agtacacaac gatcgaggga gggccggacc tggcggcgta tccgtccttc      1740
     gtcgctgagt tccgcgcggc cgttgtgcag cgcggcgtgc agcacaattt cgccctcgca      1800
     gtcaacttgg gcgcagccca gcgcggctcg tggatggagc ttgactttcc cgaaaagcgc      1860
     gcgacatttc tactgccaag tcatgtgccg ctgccgcaaa gtgaccgtct ggtgttaagg      1920
     acgacgataa cgaagtttcc gagccccaag aatgagaaga atggcaccaa ggacctgcca      1980
     acacacggcc acattgagca cacttggggt tcatcgaaga gaatcggtgt tgatgacgag      2040
     gagcctgtcg atggcgtcac gactaagaat ggtctgcact tgatgggtgt ccctctagag      2100
     cccggtactg ctttttacat ggcggtctcg gctatctcgg cggctgtata g               2151
//

If you have problems or comments...

PBIL Back to PBIL home page