(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE54

PENCW_13.PE54        Location/Qualifiers
FT   CDS_pept        117077..118711
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823846"
FT                   /orf_name="Pc16g00540"
FT                   /product="Pc16g00540 protein"
FT                   /protein_id="CAP92724.1"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000183115E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V9"
FT                   /transl_table=1
FT                   /translation="MKSEFKDKWHEAMKVQLGKLQDAKAYEIAPRPPSGCTVLPGKWVF
FT                   DLKINKDNEVQEFRARWVICGNRQRPGFDFQESYAPVARGETMRLFLSMVAVNKMIIEQ
FT                   VDYTAAYLNAMIDDRVIYMRQLTGFETRGLDGEKKDEICLVLQALYGLRQAGHLWYETL
FT                   ANALRDMDFQPLLDEPCIWIHREKQIWILLYVDDTLIAAFKAAEIDWFKTMIPFRYKDL
FT                   GKPARFLGSSLSRNNENGAIFLNQAAYTEEVVVKSGLQDASHVYLPMKTGYKCPDITRD
FT                   PKDKDVRGQNNKDIQREQNDDDDVASWAYDKPSVSKEEASAFMEDIGELGWLADKSRPD
FT                   IAVAVNKLQRRTSAPRQEDIDALKQLIRYLKGTKNLGILLGRNGDNNDLVGYVDASYQD
FT                   CEDGKSTEAYIFFHAGSPISWNSRKEEIVARSSTSAEYVAMDGAVREAMWLYKVMKQMG
FT                   IHQDLPITIFTDSDNAHTIMKKDNFAKATKWLDARYHFVRHAVRTGIISFTLIPSAENV
FT                   ADALTKPLGREQFERMREIMMYSEGKK"
     atgaagtcag agttcaagga taaatggcat gaagcaatga aagtgcaact gggaaagctc        60
     caagatgcaa aggcatacga aatagcacca agaccaccat ctggatgcac agttttacct       120
     gggaaatggg tgttcgattt gaaaatcaac aaagataacg aggtgcagga atttcgagct       180
     cgctgggtga tttgcggaaa tcgtcagcgt cccggcttcg actttcaaga aagctacgct       240
     cctgttgcac gcggagagac catgagactc tttttgagta tggtagctgt caacaagatg       300
     attatcgaac aggtggatta cacggcagct tatctcaatg ccatgataga tgacagggtg       360
     atctatatga gacaactaac tggctttgaa accagaggtc tagatggaga gaagaaagat       420
     gaaatttgtc ttgttcttca agccctgtat ggactccgac aggcaggcca cctgtggtac       480
     gaaactctgg caaatgcact gagagacatg gattttcaac ctctcctaga tgaaccctgc       540
     atctggattc atagagaaaa acagatctgg atactgcttt acgtcgatga caccttgata       600
     gctgctttca aagcagcaga gattgactgg tttaagacaa tgatcccatt tcgctataaa       660
     gaccttggaa agccagccag attcctgggg agcagtctgt cacggaataa cgaaaacggt       720
     gctatctttc tgaatcaggc tgcatacact gaagaagtgg tcgtcaaatc tggattgcaa       780
     gatgcatctc atgtctatct gccgatgaaa acaggctaca aatgcccaga catcacaagg       840
     gatccaaagg ataaagacgt tcggggacag aacaacaaag acatccaaag ggaacagaac       900
     gacgatgatg atgtggcatc atgggcatat gacaaaccat ccgtctcaaa agaagaagct       960
     tcagcgttca tggaggacat tggcgagcta ggatggctgg ccgataaatc acgacctgat      1020
     attgcagtag cagtcaacaa gctacagcgt cgaacctctg cacccagaca ggaagacatt      1080
     gatgctctaa agcagctgat tcgttaccta aaagggacga agaacctcgg aatcctgctt      1140
     ggaagaaatg gagataacaa tgaccttgtt ggctatgtgg atgcgtccta tcaagattgc      1200
     gaagatggga agagcaccga ggcctacatc tttttccatg ctggatcacc aatcagctgg      1260
     aattcccgca aggaggaaat tgtcgccaga agttccacat cagcggagta tgttgcaatg      1320
     gatggtgcag tacgtgaagc gatgtggcta tacaaggtca tgaaacaaat gggaattcac      1380
     caagaccttc caatcacaat ctttacagat agtgataatg cacataccat catgaagaag      1440
     gataatttcg caaaggctac aaaatggctg gatgcacggt atcacttcgt ccgccatgca      1500
     gtgagaactg gcatcatttc ttttactctg atcccaagtg cggaaaatgt cgcggatgca      1560
     ttgactaaac cgctgggaag ggagcaattt gaaagaatgc gagaaatcat gatgtacagc      1620
     gagggaaaga agtga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page