(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE540

PENCW_13.PE540       Location/Qualifiers
FT   CDS_pept        join(1261525..1261619,1261833..1262706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977842"
FT                   /orf_name="Pc16g05400"
FT                   /product="Pc16g05400 protein"
FT                   /protein_id="CAP93210.1"
FT                   /db_xref="UniParc:UPI0001831CE1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H879"
FT                   /transl_table=1
FT                   /translation="MQVSALTRSEVATLPIISYSTCQEIIEISQQSQIVPVFGRSPFTA
FT                   MMASSLLPLLLYFTYLPSVSAWIFSWHEPDGKLLTVQNDVSQDCKLMNNPEGNVFDWTP
FT                   QEGYWCIFLYGNTHCEEPSEGYTCKTYPWPDHVSSADLLSFKVKNNTSAFESSTSSISA
FT                   SPSPTNSDSSTSASPSSTDTTSSPTPTITTTPTADATDAASSFSATSASSDKPTISSGA
FT                   IAGIVVGVLAAVAIAGLIFFLIRRRRQNAAQSSVVAGRNATVAMAELPSPHEEKSHALN
FT                   KPIYRAQGFRELHGSDVASEIGSGIERHELDASPIYADKKY"
     atgcaagtca gcgccctaac taggagcgag gttgctacat tgccgatcat ctcgtattct        60
     acctgccaag aaattatcga aatctcccaa caaagccaga ttgttcctgt ctttggcagg       120
     tccccattca cagctatgat ggcctcttcg cttcttccct tgctgctata cttcacctac       180
     ctaccctcgg tttcagcatg gattttcagt tggcacgagc cagatggcaa attgctgacg       240
     gttcaaaatg atgtcagcca ggactgcaag ttaatgaata acccagaagg gaatgtgttt       300
     gattggaccc ctcaagaggg atactggtgc attttccttt atggaaacac tcactgcgag       360
     gagccatccg aaggctatac atgcaagacc tacccctggc cagaccacgt ctcgagcgcg       420
     gatcttttgt cattcaaggt gaagaataat acttctgctt tcgagtcctc gacatcctcg       480
     atatcagcct ctccatcacc gaccaattca gactcctcga catcagcttc cccatcatcg       540
     accgatacaa cctcctcacc aacacccacg ataaccacca cgcctactgc agacgctacc       600
     gacgctgcca gctctttttc ggccactagt gcatcgagtg ataagcccac tatctcaagt       660
     ggtgcgatcg ccggaatcgt ggtgggagtc ctagccgcag tggcaattgc tgggctcatt       720
     ttcttcctga tccggcgacg acgccagaat gccgcacagt caagcgtcgt cgccgggaga       780
     aatgcaactg tcgcgatggc ggaacttcct tcccctcatg aagaaaagtc gcatgcttta       840
     aataaaccta tatatcgggc acaaggattc cgcgaactac atggatccga cgttgcatct       900
     gagatagggt ctgggataga gcgacatgaa cttgacgcgt ccccaatcta cgcagacaag       960
     aagtattga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page