(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE541

PENCW_13.PE541       Location/Qualifiers
FT   CDS_pept        1263304..1263933
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948820"
FT                   /orf_name="Pc16g05410"
FT                   /product="Pc16g05410 protein"
FT                   /protein_id="CAP93211.1"
FT                   /db_xref="UniParc:UPI0001831CE2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H880"
FT                   /transl_table=1
FT                   /translation="MSAIPCVRSARSSSLLRLGGLQSHHINRPSIQRLHPVSRSLHSMS
FT                   SSNKVRTSPISCQKPLSLRVSILKPTARTYAGQKGSTGKAEADLLVEELQELYEVAKDE
FT                   FEIATESTDSSTIYAASDRESARDALNQLSTVYGLYTARPGEVENETDELSSQVEDSGE
FT                   SDIVETQYNPAEIPQGVKDEVRRRVGHRIRELKNAVEALEERATED"
     atgtccgcca taccatgcgt ccgctctgcg cgtagctcct cactcctccg cctcggaggc        60
     ctacaatcgc accacatcaa ccggccctcc atacagcggc tgcacccggt ctctcgctcg       120
     ttacacagca tgtccagctc taacaaagta cggaccagcc caatctcatg ccaaaagcca       180
     ttgtcgcttc gagtatcaat tctcaaacct acagcgagga cctacgccgg ccaaaaagga       240
     tccacgggca aagccgaagc cgatctcctg gtcgaggaat tacaggagct gtacgaagtt       300
     gccaaagacg agttcgaaat tgccactgag agcacggact catctaccat ctacgctgct       360
     tcggaccgcg agtctgcccg cgatgctctc aaccagctgt ccactgtgta cggcctatac       420
     actgctcgtc ccggggaagt tgaaaatgag acggatgagt tgtcatctca ggtagaggac       480
     tcgggggaga gtgatattgt cgaaacccaa tataatccgg cggagattcc gcagggtgtt       540
     aaggacgaag tgcggcggcg ggttggacat cggattcggg agttgaagaa tgctgttgag       600
     gcgcttgagg agagggccac ggaagattga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page