(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE542

PENCW_13.PE542       Location/Qualifiers
FT   CDS_pept        join(complement(1266238..1266507),
FT                   complement(1265157..1266150),complement(1264943..1265083),
FT                   complement(1264811..1264887),complement(1264728..1264755),
FT                   complement(1264615..1264677),complement(1264455..1264561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977843"
FT                   /orf_name="Pc16g05420"
FT                   /product="Pc16g05420 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93212.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831CE3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H881"
FT                   /transl_table=1
FT                   /translation="MVSQTQQGDFCLECNWEAFHIDGKTAVDPSGNALQHHLNCSSHET
FT                   QSALPHCEVDEACCDVDDCAIDCGSICGDFTGCDTPTVCSITHCEDNHCESIDPLCFEN
FT                   HCCEGTASQDCGFDALFGLNTPLSLDTGVFPSMAMGNHSVGQATKAIQHQVPGLVDPFQ
FT                   QENFLSSYQTHATHCEQDVSNHFECHDFQKDWQSMFAPPVPTQAEVNPAEVFHMLGMCS
FT                   DFSVCQDQHVPAPQNDLNTFEKPKIDTSNTFNCFHPEHHHVHSHFKNPNDFNLQATRKG
FT                   PHRNHHRCRAHTHAHTHPYSPYSRQSRSSISSHLLSSPGETPPPLEGDTSSVLTTPDFS
FT                   PDDSKLHICKWATEIHGIKAACGATFADCGSLQEHLVATHMNTVNGAKGNGYYCCWEGC
FT                   HRPDEPFSQKSKLQGHFLTHSNYKNFSCSVCGKAFARQATLDRHERSHRGDKPYTCKHC
FT                   GKSFTDSSELKTHSRTHTGEKPFKCTWPGCNFTTGDSSNMSSHRLTHGERRHKCHFPGC
FT                   TKSFTRPDQLKRHQRTTHKQEFSPSLPSPSSDHFTMTPFTLV"
     atggtgtccc aaacccaaca aggcgatttc tgccttgaat gcaattggga agcgtttcac        60
     atagatggta agactgcggt cgatccctcg ggcaatgctc ttcagcatca tttgaactgt       120
     tcaagtcacg aaacccagtc agcgctgcca cactgtgagg tcgacgaggc ctgctgtgat       180
     gtggacgact gcgcgataga ctgcgggtct atatgtggcg actttacggg ctgtgacact       240
     cccactgtct gctcaattac tcactgcgag gacaaccact gcgaaagtat tgaccctctg       300
     tgcttcgaga accactgctg tgaagggacc gcgagtcaag attgtggctt tgacgctctg       360
     tttggactca acaccccact gtcgctagac acgggtgttt tcccttccat ggcaatgggg       420
     aaccattccg ttggccaagc gacaaaagcc atccagcatc aagtacctgg tctcgtcgat       480
     ccgtttcaac aggaaaactt tctatcctca taccaaacgc atgccaccca ctgcgagcag       540
     gacgtatcca accactttga gtgccatgat ttccagaaag actggcagag catgttcgcg       600
     cctcctgttc ccacgcaggc tgaggtcaac ccagctgagg ttttccacat gctcggtatg       660
     tgttccgact tctcggtatg ccaggatcaa cacgtacctg cccctcagaa tgatctcaat       720
     accttcgaaa agcccaaaat cgacacatca aatacattca attgctttca tcctgaacat       780
     catcatgtcc acagccactt caaaaatccc aatgatttta acctgcaagc aacccgtaaa       840
     ggacctcacc gcaaccatca tcgctgccga gctcacaccc atgcccatac tcacccctat       900
     tccccttatt cgcgacaatc ccgctcgagc atcagctccc acctgctttc aagcccagga       960
     gaaaccccac cacctctcga aggtgacact tcatccgtgc ttaccacgcc ggacttttct      1020
     ccagatgaca gtaagctgca tatctgcaaa tgggcaacgg agattcatgg gatcaaggct      1080
     gcttgcggtg ctacttttgc cgattgtggt tctcttcagg agcaccttgt tgcgactcat      1140
     atgaataccg ttaacggtgc caagggcaat ggttactact gttgctggga aggatgtcat      1200
     cgtccggatg agcccttctc gcagaagtct aagcttcaag gccatttcct cactcacagt      1260
     aactataaga atttttcgtg ctcggtgtgt ggcaaggcgt ttgctagaca agcgacatta      1320
     gaccgacacg agcgcagcca tcgcggcgac aaaccataca cctgcaaaca ctgcggtaaa      1380
     tcatttaccg atagcagtga gttgaaaaca cactcgcgaa cccacactgg cgaaaagcct      1440
     ttcaagtgca cctggccagg atgcaacttc accacgggcg actcttccaa tatgtctagt      1500
     cacagactca ctcacgggga gcgaagacat aaatgccatt tcccaggatg caccaagagc      1560
     tttactcgtc ctgaccaatt gaagcgccac cagagaacaa cgcacaaaca agaattctcc      1620
     ccgtcactgc catcacctag ctccgaccac ttcactatga cccccttcac tctcgtctaa      1680
//

If you have problems or comments...

PBIL Back to PBIL home page