(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE543

PENCW_13.PE543       Location/Qualifiers
FT   CDS_pept        join(1267752..1267973,1268039..1268197)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948821"
FT                   /orf_name="Pc16g05430"
FT                   /product="Putative uncharacterized protein Pc16g05430 "
FT                   /protein_id="CAP93213.1"
FT                   /db_xref="UniParc:UPI0001831CE4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H882"
FT                   /transl_table=1
FT                   /translation="MGNICSRSSNQGDPFNQPGRVVGTSSGGTAAPRAPLPAKTNWKAT
FT                   PGRTLGESTADGSTGGTDEARANAAIAAQKRAESASANKGKLGSKLAAQKAQTQAQTLD
FT                   QVSRTERAARDVDGVEAARRWE"
     atgggcaaca tctgctcccg ctcatccaat caaggagacc ccttcaatca gccgggtcgt        60
     gtagtcggca ccagctcagg gggaactgcc gcaccccgcg ccccacttcc ggccaagaca       120
     aactggaagg ctacacccgg ccgcacattg ggcgagagca ccgcagatgg tagtactggc       180
     gggacagacg aggcacgtgc aaatgctgca attgcggcac agaaacgcgc cgaaagcgcc       240
     tctgccaata aagggaaatt gggctcaaag ctggctgcac agaaggcaca gactcaggcg       300
     cagacattag accaagtcag tcgcacagag agggctgcgc gagatgtaga tggggttgag       360
     gctgcaagga gatgggaata g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page