(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE544

PENCW_13.PE544       Location/Qualifiers
FT   CDS_pept        join(complement(1272095..1272238),
FT                   complement(1271719..1272027),complement(1268901..1271661),
FT                   complement(1268562..1268836))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000007229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948822"
FT                   /orf_name="Pc16g05440"
FT                   /product="Pc16g05440 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP93214.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831CE5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H883"
FT                   /transl_table=1
FT                   /translation="MARHGDTRSPSPVGSTYSSSRRPRREDDRYDRTRRDDGRSYRRSR
FT                   SPERRYRGRERPRDRDAYRRRDLPIDRRDEDTYRPARRDRSRERRRDDDHDFRRRSRDR
FT                   DYRSRRDDSRDRDRRRIDDSADLKLKSRRDDSRDRAASRRSRSRTREPSKPSTPVPTAQ
FT                   TDEEKKAERLAKLEAWKQKQAAEREKKQKEQASVDPKNILEAIDRKSSVSPAPAAFPGK
FT                   SKFDPKAIVKSSTSTAAAPAVLGTDVAVPTSAKAASVTKPTLASAPPATLSGPLKAKGN
FT                   VSGFGLGAKQVPETEKPSASKPLGFGDGDEGSTRKKLEKLPTTPLDVSAPVEDTGDDDD
FT                   VDMQVEGTEEHAAAEARAATERRDTRLQNHNDDVHMEESTNVQADSTPMEVDDAEEVDP
FT                   LDAFMAGLQDSTPPERTTGATFAKKKTNQQPEAMFGDDEDVDVTAVGDEKAEDVLALAA
FT                   IKKKKREMPDIDHTKIEYEPFRKEFYTEPSHLAEMTEEEVASLRLELDGIKVRGHDVPK
FT                   PVQKWSQCGLGVQTLDVVHKLGWESLTSIQAQAIPTIMSGRDVIGVAKTGSGKTGAFLV
FT                   PMFRHIKDQRPLASTDGPISMILAPTRELATQIHKDCKPFLRALGLRAVCAYGGAPIKD
FT                   QIAELKRGAEIIVCTAGRLIDLLAANQGRVLNLRRITYVVLDEGDRMFDMGFGPQVVKI
FT                   MASIRPDRQTVLFSATFPKSMEALARKTLNDPVEITVGGKSVVAREITQIVEVRNNDQK
FT                   FFRLLELLGNLYEDDANEDYRTLIFVDRQEAADDLLKQLMYKGYPCMSIHGGKDQIDRD
FT                   STIQEFKAGVFPILVATSVAARGLDVKQLKLVVNYDAPNHLEDYVHRAGRTGRAGNTGT
FT                   AVTFVTEEQDRYALDIAKALKQSGQEVPEPLQKLVDGFNEKVKAGKEKNFSRHGFGGKG
FT                   LDRLNMERETARLRERKAYKTGDEDEEEDKLETEQESDDRFNKALSAVRSAAAPAVAPA
FT                   APSASMPGVPKGVDLDGKIVVHRTERAPAGASKNPLDKVGSAVADIHARLSRAGVMRSG
FT                   VPIDNRGPDAGAFHATLEINDFPQKARWAVTNRTNVAKILEASGTSITTKGNFYAAGKE
FT                   PGPGELPKLYILVEGETEISVTTAIHELRRLLKDATLAASEGEARAPVGGRYNVL"
     atggctcgcc acggagatac tcgctcacca tcacctgtag gcagcacata ttcttcatcc        60
     cgtcggcctc gcagagagga tgatcgttat gacagaacta ggcgggatga tgggcgtagt       120
     taccgcagat cccgcagccc agagagacgg taccgcgggc gcgaacgccc tcgcgataga       180
     gatgcatatc gacgacgaga cctgcccata gatcggcgcg acgaagatac ttatcggcca       240
     gctcggagag accgatcccg ggaacggcga cgagatgacg accatgattt ccgccgcaga       300
     agtcgtgata gggattaccg ttccaggcga gatgactccc gcgatcggga ccgcaggcgg       360
     atagatgatt ctgctgattt gaagctcaag tctagacggg atgacagccg tgatcgtgct       420
     gcgagccgac ggtctcggtc tagaacccga gagccatcca aaccttccac accggtcccg       480
     actgctcaga cagatgaaga gaagaaggca gagagacttg ccaagcttga agcatggaaa       540
     cagaaacaag ccgccgaacg cgaaaagaag caaaaggaac aggcatcggt cgatcccaaa       600
     aacatactcg aagcgattga ccgtaaatcg agtgtgtctc cagctcctgc cgcatttccc       660
     ggaaagtcca agttcgaccc aaaggctatc gtaaaatcat caacctcgac cgcggctgct       720
     cccgcggtgc ttggtactga tgttgccgtt ccgacgtctg ccaaggctgc atccgtgaca       780
     aaacccaccc tagcaagtgc tccgcccgcc accctctctg gtcccttgaa agccaaaggt       840
     aatgttagcg gatttggcct gggtgccaaa caagtccctg aaacagagaa accctctgct       900
     tctaaacctc tgggattcgg ggatggagat gagggatcaa cacgcaagaa acttgagaaa       960
     ttgccaacca cgcctctcga tgtgagtgca ccggtggagg atacgggaga cgatgatgat      1020
     gtagacatgc aagttgaagg aacggaagaa cacgcagcag ccgaagctcg tgccgcaact      1080
     gaacgccggg atacacgact ccagaatcac aatgatgatg tccacatgga ggaatcgacg      1140
     aacgtgcagg ccgactctac tcccatggag gttgacgatg ccgaagaagt cgatccccta      1200
     gatgcgttca tggctggact ccaagactcg acgccgcctg aacggacaac tggggccaca      1260
     tttgccaaga agaaaacaaa tcaacaacca gaggctatgt ttggcgacga tgaggatgtg      1320
     gatgtgacgg cggttggcga cgagaaggcc gaagatgtcc ttgccctggc agcgatcaaa      1380
     aagaagaagc gggagatgcc tgatatcgac cacactaaga tcgagtatga gccgttccgt      1440
     aaggaatttt acaccgaacc atcccacctt gccgaaatga ccgaggagga ggtagcaagc      1500
     ttgcgacttg aactcgatgg catcaaggtc cgcggtcacg atgtccctaa acctgttcaa      1560
     aagtggtcac aatgcggtct aggcgtccag acattggacg ttgttcacaa actcgggtgg      1620
     gaaagcctca cgtctattca ggcccaagca atccccacga tcatgtccgg tcgcgatgtc      1680
     atcggcgtgg caaaaactgg ttcaggcaag actggcgctt tcctggttcc aatgtttcgg      1740
     catatcaaag accaacggcc cttggctagt acagatggcc ccatcagtat gatcttggcc      1800
     cccacccgtg aactggccac ccaaattcat aaggactgta agcctttctt gagggccttg      1860
     ggtcttcgtg ctgtctgcgc gtatggcgga gctccgatca aagaccaaat tgccgaactt      1920
     aaacggggcg cggaaattat tgtatgcact gctggtcgtc tcatcgatct gctggccgca      1980
     aaccaaggac gggtcctcaa tctacgccgt atcacgtacg tcgtcctaga tgagggggac      2040
     cgcatgttcg atatgggctt tgggccacaa gttgtgaaga tcatggcaag catccgaccg      2100
     gacaggcaga ctgtcctttt ttcagccact ttccctaaga gtatggaagc attggcccgg      2160
     aaaaccttga acgatccggt ggagatcact gtgggtggca agagtgttgt ggctcgagag      2220
     atcactcaaa tcgtcgaggt ccgtaacaac gaccagaaat tcttccgcct gttggagctc      2280
     ctggggaatc tgtacgaaga cgacgcaaat gaagactatc gcacgttgat ttttgtggac      2340
     cgccaagagg ccgcagatga tttactcaag cagttgatgt ataagggcta cccttgcatg      2400
     tcgattcacg gtggaaagga ccagattgat cgtgacagca cgattcaaga attcaaggcc      2460
     ggcgtcttcc ctatcctagt cgcaacgtca gttgccgctc gtgggttgga tgtcaagcag      2520
     ctcaagctcg ttgtcaacta tgatgcccct aaccacctgg aggattatgt ccatcgtgcc      2580
     ggtcgcactg gacgggctgg caacacagga accgccgtca cgttcgttac cgaagaacag      2640
     gatcggtatg ctttggatat tgcaaaggct ctcaaacaaa gtggacagga agtccccgag      2700
     cctctccaga agctggttga tgggttcaat gagaaggtca aggccggcaa ggagaagaat      2760
     ttctcacgtc atggattcgg tggtaaaggt ctggaccgcc ttaatatgga acgtgaaact      2820
     gcgcgactgc gtgagcggaa agcatacaaa actggcgatg aggatgaaga agaggataag      2880
     cttgagactg agcaggaatc agatgatcga ttcaacaagg ctctttcagc tgtccgatcc      2940
     gctgctgccc cggctgttgc accagctgca ccttcagctt ctatgccggg tgtgccgaaa      3000
     ggcgttgatc ttgatggaaa gatcgtcgtt catcgtacgg agagagcacc ggcgggtgcc      3060
     tcaaagaacc cgttggataa ggtgggctcc gccgttgcgg atatccatgc acgtttgagt      3120
     cgtgcgggtg tgatgagatc gggtgtgcct attgataacc gtggccctga tgctggagcg      3180
     ttccatgcaa cattggaaat caatgatttc cctcaaaaag cacgttgggc cgtcacaaac      3240
     cgtacaaacg tggcaaagat cctggaggca tccggtacct ccatcaccac caagggtaat      3300
     ttctacgcag ccgggaagga acccgggcct ggggaacttc ccaagctgta cattctggtt      3360
     gagggtgaga cggagatctc agtcaccacc gccatccatg agcttagacg tctgctcaag      3420
     gacgcaaccc tggcagcctc agagggtgag gcgcgtgcac cagtgggtgg ccgctacaat      3480
     gttctttag                                                              3489
//

If you have problems or comments...

PBIL Back to PBIL home page