(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE545

PENCW_13.PE545       Location/Qualifiers
FT   CDS_pept        join(1272646..1273149,1273211..1273510,1273572..1273709)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128969"
FT                   /orf_name="Pc16g05450"
FT                   /product="Pc16g05450 protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93215.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0001831CE6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H884"
FT                   /transl_table=1
FT                   /translation="MPWLSAARGGFLRTLHRGALSPRTGVSDLQHQLRRVSLTAGSDLA
FT                   RPQVQLLSSTQSMVHSNSFATASTPLKASETPKAKSSKKAGKPKKKPLSETQKEIERIR
FT                   KHRAHIRDLKATALVSGRPKRLPNNAFAIAMSEILPHVKGCSSHKEAFLVAIERAKAIS
FT                   PQDKERLQAQAKANYAANTAAYNSWVQSHTPLQIREANSARLTLSRLENKSYPPLKDDR
FT                   LVTVSRSAYTLYLKERMETEYQGKAGVESFPAIGREWLALPQAEKDRYRKLQIEDRRRY
FT                   ERECQEVYGIPAPESSHYQSPEDYLFQEEPET"
     atgccttggc tgtcggcagc tcgggggggc ttcctccgca ccctgcaccg cggtgctctc        60
     tctccccgta ctggcgtgag cgacttgcag catcaacttc gtcgcgtcag cctgacagcg       120
     ggctctgatt tggcgcgccc gcaagtccaa ctcctttcct ccacccaatc gatggttcat       180
     tcgaattcat tcgcgactgc ttccacccct ctcaaagcga gcgagacgcc caaggcgaag       240
     agctccaaga aggccggcaa gcccaagaag aagcctctca gcgagacaca aaaagaaatt       300
     gagagaatca ggaaacaccg ggctcacatc agggacctca aggcgactgc cctcgtgagc       360
     gggcgaccga agaggcttcc caacaacgcc ttcgctattg ctatgtctga gatactgccc       420
     catgtcaaag gttgctcctc gcacaaagaa gcgttcctgg ttgccataga gcgtgccaaa       480
     gcaatcagcc ctcaagataa ggagagatta caagctcaag cgaaggcgaa ctacgccgct       540
     aacaccgctg cttacaactc gtgggtccag tcgcacacac ctctccagat cagagaggcc       600
     aactctgccc gcctaactct ttcgcgtctt gagaacaaga gttaccctcc actcaaagat       660
     gaccgcttgg tcacggtatc tagatctgcc tacactttat acttgaagga acgcatggag       720
     acagagtacc agggaaaggc tggcgtggag agcttcccag ccattggccg cgaatggctt       780
     gcactacccc aagcggagaa agatcgctac cgcaaattgc aaatcgaaga tcgtcgacgg       840
     tatgagagag agtgtcaaga ggtgtatgga atcccagcac ccgagagttc tcattaccaa       900
     tcaccggaag actacctgtt tcaagaggag cccgaaacct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page