(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE547

PENCW_13.PE547       Location/Qualifiers
FT   CDS_pept        join(1281434..1281485,1281650..1282215)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948823"
FT                   /orf_name="Pc16g05470"
FT                   /product="Putative uncharacterized protein Pc16g05470 "
FT                   /protein_id="CAP93217.1"
FT                   /db_xref="UniParc:UPI0001831CE7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H885"
FT                   /transl_table=1
FT                   /translation="MNKRSNPMLRSEECSLIHPTSQRHDHIPYMHSITSQLTNPVHQIN
FT                   LQVILREDHKPCQAQTSAPEVHLKTINYTPLTPSTMSVPAAVTDYQKERTNFLSWLEDQ
FT                   ARLIRLQPKSDTISEVKVNLRERSGEYLDRLTEASILMACETSDNIYVTVKPKWFYNDM
FT                   VPKICGLLQIRIPQIAMRLGINPKCDMCVHYIIMNIVAEPGF"
     atgaataaaa gatcaaatcc aatgctgagg agtgaagagt gtagcctgat ccatcccacc        60
     tcacaaaggc atgatcatat cccctatatg cattccataa catcgcagct aaccaaccca       120
     gtccatcaga tcaatctcca agtcatcctc agagaagacc acaagccctg ccaagcacaa       180
     acctcggcac ctgaagttca cctcaaaacc atcaattaca cacctctcac accctccacg       240
     atgtccgtac cagctgccgt cacagactat caaaaggagc ggaccaactt cctatcatgg       300
     ctcgaagacc aagcccgact tatcagactg caaccgaagt cagataccat ttcagaagtg       360
     aaagtcaacc tccgcgaacg aagcggtgaa tacctagatc gactcaccga ggcgtccatc       420
     ctcatggctt gtgagacaag tgataatatc tacgttactg taaagccgaa gtggttttac       480
     aatgatatgg tcccgaaaat ttgcggtctg cttcagatta ggatacccca gatagcgatg       540
     aggcttggga tcaatcctaa atgcgacatg tgtgtgcatt acattattat gaatatcgtg       600
     gcggagccgg gtttctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page