(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE548

PENCW_13.PE548       Location/Qualifiers
FT   CDS_pept        join(complement(1284625..1284965),
FT                   complement(1284048..1284467),complement(1283060..1283860),
FT                   complement(1282605..1282995))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128970"
FT                   /orf_name="Pc16g05480"
FT                   /product="Pc16g05480 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP93218.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI0001831CE8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H886"
FT                   /transl_table=1
FT                   /translation="MPIETRTRSLELADPALLEKIDKLFACNMGEYVSLPQLVVVGDQS
FT                   CGKSSVLEALTKINFPRDSGLCTRFATHIIFRRDTNLVLREVSASIIPASDANPEEDQK
FT                   LRGWKASDLHVLQLEIRGPNESHLSVIDVPGIFNNTTSDRTTKNDIALVRNMVLSYMQN
FT                   QRSIMLAVVPANADIATQEIIEMASEIDPEEGRTLRILTKPDLVDKGAEHKVIQLIHDG
FT                   NANGQLGWILVRNLGQKQLQAGNVDRDTEERMLKDSKDLLQSLGAQRETPEQQRRILLD
FT                   IVSAFQEITRHALAANYGVNCVFDEDKDLRLATLVSLRNDVFSNDLAHWGHTYTFRSKP
FT                   ERPEDTDGSVDDREERRNNPSDTEKQQGTLQSRKNWDTTQNMSVADLEESLHVSEPVEP
FT                   PFERGILSWIEEVYSNSRGFEIGKFNPTLLSILMRKQSVKWPILARGYISDIISVVHAF
FT                   IRQALEVVSKNTQISTKIMSLLMDDLVEKYKQAISKVEFLLRIERDGTPLTLNHYFNDN
FT                   LEKCRQKRMYSTAAKNSIDNCKHGEVVRLSDLAHQHHMSNIEHTVRDIHDILDSYYKVA
FT                   RKRFLDTVCMQAADYCLVTGPEAPMKLFSPSWVNDLSNERLEEIVGEGRALKRRRRQLQ
FT                   KEIEDLEAGKAVLMK"
     atgccgatcg aaacacgcac gagaagtctg gagttggctg atccagctct acttgagaag        60
     attgacaaac tttttgcctg caacatgggg gagtatgtca gtctccccca gctggttgtc       120
     gttggagacc agtcttgcgg taagagctcg gttctcgaag ccctgaccaa gataaacttc       180
     cctcgagata gcggcctgtg cacaagattt gcgacacaca ttatcttccg ccgtgatacc       240
     aacttggttc tgcgggaggt atctgcgtct ataattcctg catcagacgc aaatccagag       300
     gaggaccaga agctgcgggg ttggaaggcc tctgaccttc acgtcctaca gctagagatt       360
     cgtggtccga atgagagcca cctcagcgtc atcgacgtcc ctgggatctt caataataca       420
     acatcggatc ggactacaaa aaatgatatc gcgctggtca ggaacatggt ccttagttac       480
     atgcaaaacc aacggtctat catgttggct gtcgtcccag caaatgctga cattgcgacc       540
     caagaaatca ttgagatggc cagcgagatt gacccagaag aaggaaggac cttgcggatc       600
     ctcacaaaac cagatctcgt tgacaaagga gccgagcaca aagtaatcca actcattcac       660
     gacggcaatg cgaacgggca gttggggtgg atcctcgtcc gaaatctcgg tcaaaaacag       720
     cttcaggctg gcaatgtcga ccgagatacc gaagaaagga tgctgaaaga ctcaaaggat       780
     ctcttgcaat ctctgggagc tcagcgagag acaccagagc agcagaggcg aatacttcta       840
     gatattgtgt cggcttttca agagattaca cggcacgccc ttgcggcaaa ttatggggtc       900
     aattgtgtgt tcgacgaaga caaggatttg cgcctggcta cattggtctc tctcaggaac       960
     gacgtctttt cgaacgacct cgcccattgg ggtcacacct acactttccg atcgaagccg      1020
     gagaggccgg aggacacaga cggcagtgtt gatgaccgtg aagaaaggcg caataacccc      1080
     tccgatactg aaaagcaaca aggtaccttg caaagccgga agaactggga tacaactcag      1140
     aacatgtcag tggcggacct tgaggagtcc ctacatgttt ccgaacccgt ggagcctccc      1200
     ttcgaacggg gcattctctc gtggattgag gaggtctact ccaattctcg gggcttcgag      1260
     ataggaaaat tcaatcctac cttactctct atcctcatga ggaagcagtc tgtcaaatgg      1320
     ccgatactcg cgcgtggcta catcagtgac attatcagcg tcgtgcatgc attcatacgc      1380
     caagcacttg aagttgtctc caaaaacact cagatctcta caaaaatcat gtccctgctc      1440
     atggatgacc ttgttgaaaa gtacaagcag gcaatttcaa aggttgagtt tctcctgcga      1500
     attgaacgcg acggtactcc gcttacactc aatcactact ttaatgacaa tcttgagaaa      1560
     tgccggcaaa agcgaatgta ttcgactgct gccaaaaatt ccattgataa ttgcaagcac      1620
     ggagaggttg tccgactgag tgaccttgcc caccaacacc atatgagcaa catcgaacat      1680
     actgttcggg acattcatga cattctcgat tcctactata aggtggctcg gaagaggttc      1740
     ctggataccg tgtgtatgca agctgcggac tattgcctgg tcactggtcc ggaggccccg      1800
     atgaagctgt tttccccttc atgggttaac gacctttcca acgagagact ggaggagatt      1860
     gttggggagg gcagggcttt gaagcggaga cgacgccagt tgcagaagga gatcgaagac      1920
     ctggaggctg gaaaggcagt gcttatgaaa tga                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page