(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE55

PENCW_13.PE55        Location/Qualifiers
FT   CDS_pept        join(119655..119718,119777..120797,120856..121078,
FT                   121249..121270,121513..121791,121848..121957,1
FT                   22006..122206)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945528"
FT                   /orf_name="Pc16g00550"
FT                   /product="Pc16g00550 protein"
FT                   /protein_id="CAP92725.1"
FT                   /db_xref="UniParc:UPI000183115F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W0"
FT                   /transl_table=1
FT                   /translation="MLGLFRASLIAPLLTVWICCSNAFAANCSSTWIKSVADADKLRQN
FT                   CRIVYGHVGIGPFADNGTVHINLDGVEMIAGTLGESPLMQSDDVTQPYYTLSSSSLEVV
FT                   DAVEIGYYGTKVVNLSLPSLKSARDYFEVGKRAYNLTYLDISSLNFAPSITLSPPNLTT
FT                   LHHTGLRNVTAMSIDAMKIDSLDSLTDNQLNMSQVFIQGPFPNVNEIAIGFISAKHLHI
FT                   NDNSSLTLGGSSTTAMTIKELSLHGITDLKRSAQLQTLKVDTLKLSSSISITDLEIPFD
FT                   DLRSLNIQQRWETHPMKSITLPPKAVDWTGGFDLDIVGAPDLNLTSIYGVNDKGNHVQT
FT                   WYWPKNVSRIRISDVTVGNAFFDPFVAQQKGPWDSQFPPSAVRSFGVSPSVNSSFNCTP
FT                   FVELQSMGRLPDVPFMCDDSKPPTSGVPVHLPIPLSLVILLNVVDSTYLLQQPTSLHHG
FT                   NKNLKAKRATKNDALNKHITRTCKKSVKWKGKTRMLSGSPDYGIWYGEEEDLDLNVVIM
FT                   EAKRPNSASEGVPQALAYMGCVHKQRKDLGKADTTVYGISTDAMNFTFMKLDNKSQWSF
FT                   KLVGVVANGFEQVLGLLVYLMTKAALMSPASSRHASRRAQQGSGGSELSFDHDPENYDQ
FT                   MDIA"
     atgctcgggc tcttccgtgc atcgctgatt gcaccactgc taaccgtatg gatatgctgc        60
     tcaaatgcct tcgctgccaa ttgcagctcc acctggatca agtccgtggc tgatgctgat       120
     aaacttcgtc agaactgtcg aatcgtctac ggacacgtcg gaatcggtcc atttgctgac       180
     aatggcacgg tccatatcaa cctcgacggt gttgaaatga ttgcaggcac cctcggggaa       240
     tctcctctta tgcagagtga cgatgtcacc caaccctatt acacgctctc cagttcatct       300
     ttggaggtag tcgatgcagt cgaaattgga tactacggaa ccaaagtggt caacctctcg       360
     cttccgagtc tcaaatccgc gagggactac tttgaggtag ggaaacgggc ctacaatctg       420
     acctaccttg atatctcgag tctgaacttt gcgccaagca ttacgcttag ccccccgaat       480
     ctcacgactc tccaccacac agggttgcgc aatgtgacag ccatgagtat tgacgccatg       540
     aaaatcgact cgctcgatag cttgactgat aatcaactca acatgagtca ggttttcatc       600
     caaggcccct tcccgaatgt caacgaaatt gctattggtt tcatctctgc caaacacctc       660
     cacatcaatg acaattcatc tctcactcta ggaggctcct cgacaacggc aatgaccatc       720
     aaagaacttt ccctccatgg tattacggat cttaagcgta gcgcacagct tcagacactc       780
     aaggttgata ctctgaagtt atcaagctcc atttctatca ctgaccttga aatcccgttt       840
     gatgatctcc gctctcttaa catccagcaa cgatgggaga cccatcccat gaaatctatc       900
     actcttcccc ccaaagctgt ggattggaca ggtggctttg acctcgacat tgtcggcgca       960
     cccgatctga atttgacgtc gatttacggt gtcaacgaca aaggcaatca cgttcagact      1020
     tggtactggc caaagaatgt ctcgcgtatt cggatttccg acgttactgt aggaaatgca      1080
     ttctttgatc cttttgtcgc gcagcagaag ggcccttggg acagtcaatt tcctccatcg      1140
     gccgtacgtt catttggagt tagtccatca gtcaactcta gttttaactg cacgccattc      1200
     gttgagctcc agagcatggg tcgtttgccg gacgttccat tcatgtgcga cgattccaag      1260
     ccgcctacca gtggcgttcc tgttcatcta ccaattccgc tcagccttgt tatattgctg      1320
     aacgtcgtgg attccaccta tctattacag caacccacct cattgcatca cggcaacaag      1380
     aacttaaagg ctaaacgggc aacgaaaaat gatgcgctta ataagcatat cactcgaacc      1440
     tgtaagaagt ccgtgaaatg gaaggggaag acacggatgc tgtcagggag tcccgactat      1500
     ggcatctggt atggagagga ggaagacctc gacttgaacg ttgtcatcat ggaggccaag      1560
     agaccgaaca gtgctagtga aggggttccg caggcgctgg catatatggg gtgcgtccac      1620
     aagcagcgta aagaccttgg caaagcagac accaccgtct acggtatctc caccgatgct      1680
     atgaatttca cgttcatgaa gctggacaat aagtctcagt ggtctttcaa gctagtcggt      1740
     gtcgttgcaa atgggtttga acaagtgctt ggtctactgg tgtacctgat gacgaaagcg      1800
     gccttgatgt cacccgcctc ctccagacac gcatctcgtc gggcacaaca aggatcaggg      1860
     gggtctgagt taagcttcga ccatgacccc gagaactatg atcagatgga tattgcctga      1920
//

If you have problems or comments...

PBIL Back to PBIL home page