(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE554

PENCW_13.PE554       Location/Qualifiers
FT   CDS_pept        join(complement(1293769..1293994),
FT                   complement(1293374..1293699))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824624"
FT                   /orf_name="Pc16g05540"
FT                   /product="Putative uncharacterized protein Pc16g05540 "
FT                   /protein_id="CAP93224.1"
FT                   /db_xref="UniParc:UPI0001831CED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H891"
FT                   /transl_table=1
FT                   /translation="MPKPSRLQDLKIPINTDENWDADDEDCGSDTTLDSFDSVPLSLAL
FT                   GSKDDGKGPFDKSLFHFSVNREETNLLGAPGTDLEWTATFEQWRPQWNKIQVQAKRFGY
FT                   TQFSSEIAPAPVDLALVRFVGFGHDQEHREFEIEQEGQDSIADCQDIWTLWRYIIETPA
FT                   NQIREFHVCLRDTARLVGLQ"
     atgccgaagc catctagact ccaggatctg aagatcccta ttaacaccga cgagaactgg        60
     gatgcagatg acgaggactg tggttctgac accactttag attcgttcga ctctgtgccg       120
     ctgtcgctgg cactggggtc aaaagatgac ggcaaaggcc cattcgacaa atccttattc       180
     cattttagtg tcaaccgcga agaaactaac ttactaggcg caccgggcac tgatctggag       240
     tggacagcga cattcgaaca atggcgaccc cagtggaaca aaatccaggt acaggcgaag       300
     aggttcggat atactcagtt ttcttcggag atcgctcctg cgccggttga tcttgctttg       360
     gttcgattcg ttgggttcgg acatgaccag gaacacagag agtttgagat tgaacaggag       420
     ggccaggata gtattgctga ttgtcaggat atttggactc tctggcgata cattattgag       480
     actcctgcaa accagattag ggagtttcat gtctgcctca gggatacagc gagacttgtt       540
     ggccttcagt ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page