(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE555

PENCW_13.PE555       Location/Qualifiers
FT   CDS_pept        join(complement(1295701..1295730),
FT                   complement(1295421..1295610),complement(1295307..1295349),
FT                   complement(1294729..1295231),complement(1294448..1294695))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948825"
FT                   /orf_name="Pc16g05550"
FT                   /product="Pc16g05550 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93225.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001831CEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H892"
FT                   /transl_table=1
FT                   /translation="MYNTPSDIWVAGAFAAVAVDFIVYPFDTLKTRVQSPDYEKVFKDA
FT                   RTGAVRRDLLFRGLYQGVWSVVFSTIPASGAFFTTYEAVKSIILRLPFTHSLPTPIMHG
FT                   IASSTGEMVSCLMITPAEVLKQNAQMIQGSQTNTSAMRQVLSRFRRHPWRLWSGYTALV
FT                   GRNLPTTALQFPLFEYVRSHLINRRRQRKANRSNTGRPPSEQSDQLVERAGLTGIAAAI
FT                   SGTVAATVTTPIDVIKTRVMLSAGEAGASSQDPISSGARTKTKSLISVGRNIVQYEGIR
FT                   GLFKGGLIRAGWTAIALGLYLSLYEGGRFYLENRRKERDLLNGKLRRPTDEGVEGL"
     atgtacaaca ctccttccga tatttgggtt gcaggcgcat ttgctgcagt tgcagtcgac        60
     ttcatcgtct acccattcga cacactcaag acccgtgtcc agtccccaga ctatgagaag       120
     gtcttcaaag atgcgcgcac aggagcagta cggcgcgatc tactcttccg aggattgtac       180
     cagggcgtct ggagtgtggt tttctcgact attccagctt ccggtgcatt ctttaccaca       240
     tacgaagctg tgaagagcat tattcttcgc ttgcctttca cgcattccct cccaactcca       300
     attatgcatg gaattgcctc ttcaaccggg gagatggtat catgcctcat gatcaccccg       360
     gcagaggtac taaagcaaaa tgcgcagatg attcaaggtt cccaaacaaa cacatctgcc       420
     atgcggcaag tactttcgcg atttcgacgt catccttggc gtctatggag tggatacaca       480
     gcactggttg gtcggaacct cccaacgacc gctttacaat ttccgctctt tgagtatgtg       540
     cggtcacacc tgattaaccg acggaggcaa cgtaaagcga atcgcagcaa caccggccga       600
     cccccatcgg aacagtcaga tcagctagtc gaacgggccg gcttgacggg tatagctgcg       660
     gcaatttcgg ggacggttgc ggcaacagtg actaccccaa ttgacgtgat caagacccgc       720
     gttatgcttt cggcaggtga agctggtgct agttcccagg atccaatatc ttcgggggca       780
     cgaacaaaga ccaaatctct tatatctgtc ggtcgtaata tcgtacaata tgagggcatt       840
     cgtggcttgt ttaagggcgg actaatacgg gctggttgga cggcaattgc attgggcctg       900
     tatctcagcc tttacgaagg aggccggttt tatctggaga atcgacggaa ggagcgggac       960
     cttctcaatg gaaagcttcg aaggccaact gacgaaggtg ttgaagggct ctaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page