(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE556

PENCW_13.PE556       Location/Qualifiers
FT   CDS_pept        complement(1296079..1297401)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000249874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948826"
FT                   /orf_name="Pc16g05560"
FT                   /product="Pc16g05560 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93226.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="UniParc:UPI0001831CEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H893"
FT                   /transl_table=1
FT                   /translation="MFQRRTVVAAKRSVAQWRSLATASPVSSARNHKIVVVGGGTAGLS
FT                   ISHQLLHSGKFAQDDIAVVDPAAWHNYQPGWTLVGGGLKDKQELRKPLNTLIDPKFKFY
FT                   NEGVGAFAPTENALTLENGDKINYEHLVVVPGINLNFGAIKGLSEALADRNSTVSTIYS
FT                   YDTCDKAFRNIENFHGGNAIFTQPAGVIKCAGAPQKIMWLALDHWKRAGLYNPASPSES
FT                   PVKISFATGLPMMFGVPKYSAVLEQMRKDRGVEGLFQHDLLAIDGKAAIFASPEGEVAK
FT                   QFDLLHVTPKMGAHAFVKNSALANEAGYVDVDDNTTRHKKFPNVWSAGDASSLPTSKTA
FT                   AAVTSEAPVLVRNLLQSMEGKALDASYDGYTSCPLLTEYGKVLLAEFKYAGVPKETFGD
FT                   WFGIDQAEPRRSFYHLKKDFFPWVYFNYMLKGNWAGPKGWQ"
     atgtttcagc gtcgcacagt agttgctgcc aagcgctcag tcgctcaatg gaggagcctc        60
     gcaaccgcgt ctcccgtgag ttctgcacga aaccacaaga ttgtagtggt cggcggtggt       120
     actgctggtc tctccatcag ccaccagctg ctgcactctg gcaaatttgc gcaagatgac       180
     attgctgtag tcgatccggc agcgtggcat aactaccaac ctggctggac actggttggc       240
     ggaggcctca aggacaaaca ggagctgcgc aagccattga acaccttgat cgatcctaaa       300
     ttcaagtttt ataacgaggg tgttggcgcc tttgccccca cagaaaatgc gctcaccctc       360
     gagaatggcg acaagatcaa ctacgagcat ctggtcgttg tgcccggtat taacctcaac       420
     tttggcgcca tcaagggtct ctctgaggct ctggcagacc ggaactcaac ggtgtcaaca       480
     atctacagct acgacacatg cgacaaggct ttccgcaaca ttgaaaactt ccacggaggc       540
     aatgccattt tcactcagcc agccggtgtg atcaagtgtg cgggcgcacc gcagaagatc       600
     atgtggcttg cattggatca ttggaaacga gctggccttt acaaccctgc cagcccctct       660
     gagtcacccg tcaagatcag ctttgccacc ggtctcccaa tgatgttcgg tgtccccaag       720
     tacagcgccg tcctcgagca gatgcggaag gaccgcggtg ttgagggatt gttccaacac       780
     gatctcctgg ccattgatgg caaggctgcc atctttgcct ctcccgaggg agaggtcgcc       840
     aaacaattcg acctgttgca cgtcacccct aagatgggtg ctcatgcttt cgtcaagaac       900
     agtgctctgg ccaacgaggc cggatacgtc gatgtggacg acaacaccac ccgccacaag       960
     aaattcccca atgtctggtc tgctggtgat gcttccagtt tgcccacatc caagaccgcc      1020
     gcggcagtca cctctgaggc accagttctc gttcgcaacc ttttgcagag catggagggc      1080
     aaggcactgg atgcttctta cgatggatac acctcatgcc cgctcctgac cgagtatggc      1140
     aaggtccttc ttgccgagtt taagtacgcc ggagtaccca aggagacatt tggtgactgg      1200
     tttggtattg accaggccga gccccgtcgt tcgttctacc acctgaagaa ggacttcttc      1260
     ccttgggtgt acttcaacta catgctcaag ggtaactggg ctggaccgaa gggctggcaa      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page