(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE58

PENCW_13.PE58        Location/Qualifiers
FT   CDS_pept        join(complement(130406..130685),complement(130029..130352),
FT                   complement(129863..129912),complement(129619..129810))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671094"
FT                   /orf_name="Pc16g00580"
FT                   /product="Putative uncharacterized protein Pc16g00580 "
FT                   /protein_id="CAP92728.1"
FT                   /db_xref="UniParc:UPI0001831160"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W1"
FT                   /transl_table=1
FT                   /translation="MPSSKKVTKRSSDSRSLLHRILVAIYDFTGRMIDQEQLESTADEI
FT                   EKALDKNYPTLAISSLFINDIEKIIKLKWTRKDTELADLRPMECPPVLVQQIDKITRAL
FT                   GRSHPSEENGRWILNSLLLEAYEIATVICPHAAQPLNIQAERGWKYGPVKWHRRKYFLT
FT                   GRPDYGVWYGEEEAVSLNVVIVEAKRELGGMEQALGYMASNGYDFVFLKIDNDSKWSDR
FT                   KITTRDGNYDEVLGVLVHMFTKAAVMSPAHSKEPPRQQQSSGESAATKLSVQEDVEMAG
FT                   "
     atgccgtcca gcaagaaagt aactaagaga tcatcagaca gcagatcttt gcttcacaga        60
     attttagtgg ctatttacga cttcaccggc cggatgattg accaggagca acttgaaagc       120
     accgctgatg agatcgagaa agctcttgat aaaaactatc ccaccctcgc aatttcttcc       180
     ctttttataa acgatattga gaagatcatc aagttgaaat ggactcgtaa ggacactgag       240
     ctggctgatc ttcgtccgat ggagtgcccc cccgtgctag tgcagcagat cgacaagatc       300
     actcgcgccc tcggtcgaag tcatccaagt gaagaaaacg gccgttggat cctcaactct       360
     ctactcctcg aagcgtacga gatcgccacg gtcatctgcc cccacgccgc ccagcccctt       420
     aacattcagg cagagagggg ttggaagtat ggtccggtaa agtggcatcg caggaagtat       480
     ttcttgaccg gtcggcctga ctatggagtc tggtacggcg aagaggaagc ggtctcattg       540
     aacgtggtta ttgtggaagc caagagagag ctaggcggaa tggaacaagc actaggttat       600
     atggcctcga acgggtatga cttcgttttt ctcaaaattg acaacgattc taagtggtct       660
     gaccgtaaga tcaccacccg agacggcaac tatgacgagg tccttggagt actggtgcat       720
     atgttcacca aggccgcagt gatgtctcca gctcactcca aggagccacc ccgacagcag       780
     caatcctcgg gcgagtcggc agcgaccaag ctttccgtgc aagaagacgt ggagatggcc       840
     ggctag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page