(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE59

PENCW_13.PE59        Location/Qualifiers
FT   CDS_pept        join(131067..131269,131330..131493,131588..131829,
FT                   131889..132059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076650" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945529"
FT                   /orf_name="Pc16g00590"
FT                   /product="Pc16g00590 protein"
FT                   /protein_id="CAP92729.1"
FT                   /db_xref="UniParc:UPI0001831161"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W2"
FT                   /transl_table=1
FT                   /translation="MSDNTRPPQPSSLITQRSCADFQDLESFKDCLASIAQVKEHHEFV
FT                   LLDIPRDWADIVFEVLDEVVSARKMYNSRTDVLRVLTMPTAIQNCIQPWLYNQLFNWGI
FT                   TGAITPSEENMIHGEAGTKPDFLFMIRGRLLPTVAVESGWSDPMPRLQDDLNMLLVGGD
FT                   GSIKVVIIIKWSRHAPNRVSGVAELYKCDRNGIPVRDQREVIFPHNPTTGNQQLVIKRR
FT                   DLLGSGHGNPAGSLFFDLDLLRDFASRALGRMNLVPA"
     atgtcagaca atacccgtcc tcctcagcca tcctcgttga tcacacagcg atcatgtgca        60
     gacttccaag atctcgagtc tttcaaagat tgtctcgctt ccattgccca agtgaaggaa       120
     catcacgaat ttgtcttgct ggacatccct cgtgattggg cagacattgt gttcgaggtc       180
     ctggacgagg ttgtttctgc gcgaaagatg tacaacagca ggacagacgt gctaagagtg       240
     ctcactatgc ctacagcaat acagaactgc atccaaccgt ggctttacaa tcaattgttc       300
     aactggggta taactggagc tatcacgcca tccgaagaga acatgatcca tggagaagct       360
     ggaacgaagc cagacttcct ttttatgatc cgtggccgct tgctgccaac tgttgctgtt       420
     gaatccgggt ggagtgaccc gatgccacga ttacaggatg acctcaacat gttgctggtt       480
     ggaggtgatg gcagcatcaa agtcgtcatt atcatcaagt ggtcgcgaca cgccccaaat       540
     cgtgtttccg gtgttgcaga actatacaag tgcgacagga acggaatacc agtgcgcgac       600
     caacgtgagg tcattttccc ccataatcct acgacaggca accaacaact cgtcattaaa       660
     cgacgtgacc tgcttggctc agggcatggc aatcccgccg gttccctctt cttcgatctc       720
     gatcttttac gagactttgc gagtcgtgct cttgggcgta tgaaccttgt acccgcttaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page