(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE6

PENCW_13.PE6         Location/Qualifiers
FT   CDS_pept        complement(16511..17662)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945507"
FT                   /orf_name="Pc16g00060"
FT                   /product="Pc16g00060 protein"
FT                   /protein_id="CAP92676.1"
FT                   /db_xref="UniParc:UPI0001831CCE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R6"
FT                   /transl_table=1
FT                   /translation="MSDTGSGSGSRGESSRRLPAPQPQPVTQGTRLSEKTDVKWMKACT
FT                   LRVDGSNFVRWKREITNGLRMTRIENVVNFNLPKPKEDDPEYDTWYYWSVYTLGWISST
FT                   LDNEITTILEGSIQQFPEYADDLMKEITRIVSGDNKVLNVGAEVLKFDKLKRENYTTAK
FT                   DYIMAYQRQFNILGRYGVAPHPFAALYTMLHALREELPSVNFTFDTLKRQVPTETTMND
FT                   FGEYCKELIIESNTTTEETSPGLAKTTRSSSPSSSSRGGRGQRGRGGRIGRGNDWRKPK
FT                   EDNKVDDKGEAKDEPEEKQLRGAPPKGADIDEWAERQRCQQPQYINGTECTHCRLDGHP
FT                   AKACFHLMEEFVFDGWEPFPEVWCYATARMEKKDAKDAKDGKK"
     atgtctgaca ctggatctgg atctggatcc cgcggggaga gctctcgtcg gctccctgca        60
     ccccaacccc aacctgttac gcaaggaacc cgccttagtg agaaaactga tgtgaaatgg       120
     atgaaagcct gcaccttacg cgttgatgga tcgaactttg tgcgctggaa gcgcgaaatc       180
     acgaatggac tacggatgac ccggatcgag aacgttgtga atttcaacct gccgaaacca       240
     aaggaagacg acccggagta cgatacctgg tattactggt ccgtctacac cctcggctgg       300
     atctcgtcga cactagacaa tgaaatcacg actatcctcg aaggttcaat tcaacaattc       360
     ccggagtacg ccgatgactt gatgaaggag atcacccgga ttgtgagcgg tgataacaag       420
     gttttgaacg tcggtgcgga ggtcttgaaa ttcgacaaat tgaaacgaga gaattacact       480
     acggcgaagg actacattat ggcttatcag aggcaattca atattctcgg acgttacggt       540
     gtcgcaccgc acccttttgc tgcactttac accatgcttc acgcacttcg tgaagagctc       600
     ccgagcgtga atttcacttt tgatactctg aaacgccaag tcccgaccga aaccacgatg       660
     aatgactttg gtgaatactg caaagagctg attattgagt cgaacacaac tacggaggag       720
     acaagccctg gtctggcgaa gacaacccgt tcttcgtcac cctcgtcttc ttcacgcggc       780
     ggacgtggac agcgcggtcg tggaggccgt attggacgtg gaaatgactg gcggaaaccg       840
     aaggaagata acaaagttga tgacaaaggt gaagcaaagg atgaaccgga agagaagcag       900
     cttcgtggag cacccccgaa aggagctgac attgacgaat gggctgagcg ccagcgttgt       960
     cagcagcctc agtatatcaa cggaactgag tgcacacact gccgtctcga tggacaccct      1020
     gcaaaggcat gcttccacct gatggaagaa ttcgtttttg atggatggga gccgttcccg      1080
     gaggtctggt gctacgctac agcacgaatg gagaagaagg atgcaaagga tgcaaaggat      1140
     ggaaagaagt ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page