(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE60

PENCW_13.PE60        Location/Qualifiers
FT   CDS_pept        join(132601..133028,133090..133357,133409..133659,
FT                   134166..134325,134407..134532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945530"
FT                   /orf_name="Pc16g00600"
FT                   /product="Pc16g00600 protein"
FT                   /protein_id="CAP92730.1"
FT                   /db_xref="UniParc:UPI0001831162"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W5"
FT                   /transl_table=1
FT                   /translation="MTPTSSPSPKIKDVVVNILHTLKSIDHAHLTKSEIQRLGVSVDIF
FT                   DPNDEDSSDEDSLDPETQWLFKPISKEDIKPWKISPSEAKAVQSSLDIPELVRASQHRP
FT                   DWDVTGATQEVLHFITTQFDFRRKSKTPLRDTFGWNDIDFDEFAGGNVGLLFSIGGKFR
FT                   GVDTPGWRTGLIEEWWDGEDLAGPSVRLIICTDSNGKEGNLLLSELGSIAQVVAFRRNQ
FT                   PGFETYRLFPVLLISLFGPRHGRIIQACYDRRSNKFELRISRVFCFVTKEDAVFDTFLR
FT                   FTASYPPEIANPQFSRLARATLSQRPLAHRPARRGRDDNPMEPEAPLSEAYQDTGYYDD
FT                   MGPAYGDYDPGVRDGAFDDGGGYYDDDDRINHHVCAVRSRLFESKNKLFRHLPNCDTAA
FT                   QPAGDQAGHCR"
     atgacaccca cctcttcccc gtcccccaag ataaaggatg ttgttgtcaa catcctgcat        60
     acgttgaagt cgatcgacca cgcacatctc actaaatccg agattcagcg tttaggagtc       120
     tccgttgata tttttgaccc gaacgatgaa gactcctccg acgaagattc cttggacccc       180
     gagacgcaat ggcttttcaa gccgatttct aaggaggaca tcaaaccgtg gaagatctcg       240
     ccctctgagg cgaaggcggt gcaaagcagc ctggacatcc ccgagttggt tcgtgcgtcg       300
     cagcatcggc ctgactggga cgttacaggc gccacgcaag aggtgctcca ctttatcacg       360
     acgcagttcg actttcgccg caaatcgaag actcccctaa gggatacatt cgggtggaat       420
     gacatcgatt ttgacgagtt cgctggcggc aatgtgggac tccttttctc cataggtgga       480
     aagtttcgag gcgttgacac cccgggctgg agaactggct tgatagaaga gtggtgggat       540
     ggtgaagacc tcgctggacc ttccgtccgt cttatcatct gcacggactc gaatggcaag       600
     gaaggcaatc tactactaag tgagctcgga tcaatcgctc aggtcgttgc gttccgccga       660
     aaccagccgg ggttcgagac ttatcgtcta ttcccagtac tcctgatttc gctcttcggg       720
     cctcgacacg ggcggatcat tcaggcctgc tacgaccggc gcagtaataa gtttgaactt       780
     cgaatttctc gagttttctg cttcgttacc aaggaggacg ctgtatttga tacattcctt       840
     cgattcacag cgagctatcc tcccgagata gcaaatcccc aattttcacg tctcgctcgt       900
     gcgacgctct ctcagagacc cttagcgcat cgccctgcac gtcggggccg tgacgacaac       960
     cccatggagc ccgaagcacc gctaagcgaa gcgtaccagg acactggata ctatgacgat      1020
     atgggacctg catacggcga ctacgacccc ggtgtgcgcg acggagcctt cgatgacggt      1080
     ggcggatact acgacgacga cgatcggatc aatcatcacg tgtgcgcagt gaggagcagg      1140
     cttttcgaat ccaagaacaa gctcttccga cacctgccca actgcgacac cgcagctcaa      1200
     ccagctgggg accaggcagg ccactgtcgg tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page