(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE63

PENCW_13.PE63        Location/Qualifiers
FT   CDS_pept        join(140375..140533,140588..140626,140677..140792,
FT                   140844..140952,141001..141229,141274..141436,
FT                   141484..141630,141686..141926,141976..142644)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165530" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823847"
FT                   /orf_name="Pc16g00630"
FT                   /product="Pc16g00630 protein"
FT                   /function="alpha-amylase activity"
FT                   /function="calcium ion binding"
FT                   /function="carbohydrate binding"
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAP92733.1"
FT                   /db_xref="GO:0004556"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831164"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W6"
FT                   /transl_table=1
FT                   /translation="MKKVIFTATILLWQMVMGLTPAEWRSQSIYFLLTDRFGRTDNSVT
FT                   ANCNVDDRAYCGGTWQGIINQLDYIQGMGFTAIWITPVTKQLPQDTGYGMAYHGYWQQD
FT                   IYDVNDHHGTSDDLLALSKALHARGMYLMVDVVANHMGYAGAGNTVDYSVFTPFSSSSY
FT                   FHPYCLISNYNDQSNVENCWLGDTTVSLPDLDTTQNSVQTIWNDWIADLVTKYSIDGLR
FT                   IDTVKHVQKSFWPGFNDAAGVYAVGEIFDGNPAYTCDYQNYMDGVLNYPIYYPLLRAFQ
FT                   SSSGSISDLYNMVGTVASSCADSTLLGNFIENHDNPRFPSYTSDYSQAKNVISFLFLSD
FT                   GIPIVYAGQEQHYSGGHDPANREAVWLSGYSTTAELYQHIATTNKIRKAAVAADSSYIT
FT                   SKNVPFYQDSHTLAMKKGSGSSPVITVLSNAGSSGSSYTLYLGGSGYSSGTKLMEMHTC
FT                   TSITVDSSGKIAVPMVSGLPRVLIPASSVSNSGLCGSSVPSATATQTTTATTTGAGCTQ
FT                   ATALPVLFKELVTTVYGQDIYISGSISQLGNWDTSQAIALSSSSYTASNPLWQTTITLP
FT                   VGTTFQYKFLKKTTGSSTVTWESDPNRSYTVPTGCTGATATVAASWK"
     atgaagaagg ttatattcac agcaaccata ctgctatggc agatggttat gggcctgact        60
     cctgcggaat ggcgcagcca gtcaatctat ttcctgttga cggatcgctt cggacgcacc       120
     gacaactcgg tcactgccaa ctgtaatgtc gatgacagag cctattgtgg tggcacttgg       180
     cagggtatta tcaatcaact ggactatatc cagggaatgg gctttacagc catttggatt       240
     actccagtga caaagcagct cccacaagac accggttatg ggatggccta ccatgggtac       300
     tggcagcaag acatatacga tgttaatgat caccatggca cgtccgatga cctcttggca       360
     ctttcaaagg cactgcacgc tcgaggcatg tatctcatgg ttgatgttgt ggcaaaccat       420
     atgggctacg ctggggctgg aaatacggtg gattacagtg ttttcactcc cttcagctca       480
     tcatcctact tccaccccta ttgtctaata agtaactaca atgaccagtc caatgtcgag       540
     aattgctggc ttggtgacac cactgtgtcg ctgccagatc tggatacaac ccagaactcg       600
     gtgcagacca tctggaacga ttggattgct gatctggtga ccaaatactc cattgatgga       660
     ttgcgcatcg ataccgtgaa gcatgtccag aagtctttct ggcctggctt taatgacgca       720
     gcaggtgttt atgctgtcgg ggagatcttt gacggaaatc cagcttacac ctgcgactac       780
     caaaactata tggacggtgt cttgaattat cccatctatt acccactcct acgtgcattc       840
     caatcctcca gcggcagcat cagcgacttg tacaacatgg tcggtactgt ggcctcttca       900
     tgtgccgatt caaccctgct gggcaatttc atcgagaatc acgacaatcc acgtttccca       960
     agctacacaa gcgactactc acaggccaag aatgtgatct ccttcctctt tttgtcggat      1020
     ggaataccca ttgtatatgc cggtcaggag caacattata gtggtgggca cgacccagcc      1080
     aaccgcgaag ccgtctggct gtcagggtac tctacaacgg cagagctata ccaacacatt      1140
     gcgactacga acaagatccg gaaagcggca gtcgcagcag actccagcta catcacgtcc      1200
     aagaatgtcc ccttctatca agacagccat acattagcta tgaagaaggg atccggaagc      1260
     tcgccagtca ttaccgtgct ttccaacgcc gggtcatctg ggtcctcgta tacattgtat      1320
     ttgggtggga gcggatattc atccggcacc aagctgatgg agatgcacac ctgcacatct      1380
     atcaccgtgg attccagcgg taaaattgcc gtgccaatgg tatctggatt gccacgagtg      1440
     ctcattcctg catcatccgt gagcaacagc ggactgtgcg gctcatctgt ccccagtgcc      1500
     acagcgactc agaccactac agcaaccacc actggggcag gctgcaccca agccactgct      1560
     ctgcctgttc tattcaagga gcttgtgact actgtctatg gtcaagatat ctatatctca      1620
     ggatcaatca gccaacttgg aaactgggac acgagtcaag ccatcgcact gtcttcaagc      1680
     agctacactg cttccaatcc cttgtggcag acgactatca cactccccgt cggaacaact      1740
     ttccagtata aattcctcaa gaagacgact ggatcttcaa ctgtgacctg ggaaagtgac      1800
     cctaatcgat cttatacggt gccgactggg tgtactggag ctacagccac tgtggcggca      1860
     agctggaaat ga                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page