(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE64

PENCW_13.PE64        Location/Qualifiers
FT   CDS_pept        complement(142868..144571)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945532"
FT                   /orf_name="Pc16g00640"
FT                   /product="Pc16g00640 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92734.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI000183123A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W7"
FT                   /transl_table=1
FT                   /translation="MPSILKLILLFALPLVWAVPAQRRAPSANPTVIISKPETTVVGST
FT                   GLNKIDQFNGIPFALPPTGSLRLKPPQPIQTSLGTIQATSAARSCPQFSFSTDEKDLPS
FT                   SIIAKLINIPLFQEITNAGEDCLTLDVRRPSGTQADAKLPVLVWIFGGGFEQGATTSYD
FT                   GSHIVTSSVKLGMPVIFVAMNYRLGGFGFMPGAEIRKDGSANLGLRDQRLALQWVADNI
FT                   AAFGGDPSKVTIWGESAGAISVFDQMAMYDGDNIYNGVPLFRSAIMNSGSIVPANPVDG
FT                   TKGQTVYDTVVKNAGCSGVSDTLACLRHLDYTKFLNAANSVPGILGYNSVAESYLPRPD
FT                   GTILTQSPDQLVIQGKYASVPFIIGDQEDEGTIFALYQSNLTTTDDIVDYLQNLYFFDA
FT                   SRQQLESLVATYQDIKEDGSPFRTGSLNNWYPQYKRLAAILGDLSFTLTRRVFLNYAKK
FT                   VRPDVPSWSYLSTYDHGLPFLGTFHGSDVLQVFHGILQNYGSKAIHSYYLSFVYDQDPN
FT                   TRACDYMDWPQWANNQSLMEFSIDRGGLLPDNFRQDSYNQIMADPPAFYI"
     atgccttcta tcttgaaact gatcttgttg tttgctttgc ctctagtctg ggccgttccg        60
     gcgcaaagga gagcaccttc agccaaccca actgttatca tctccaaacc tgagaccacg       120
     gtggttggct ccacgggtct caacaagatc gatcaattca atggcatccc gttcgcactg       180
     cctccgactg gctccctccg attgaaacca cctcaaccaa tccagacatc cctcggaacc       240
     atccaggcta cttccgctgc gaggtcttgc ccgcaattca gttttagcac agacgaaaaa       300
     gacttgccta gctctatcat tgcgaagctc atcaatatcc cacttttcca ggagatcacc       360
     aatgctggcg aggactgttt gactctcgat gtacgacgtc cttccggaac ccaggcagac       420
     gcgaagctac cggtgctggt ctggatcttc ggtggtggct ttgaacaagg tgctaccaca       480
     agctacgatg gatcacacat tgtgacaagc tctgtgaaac tgggtatgcc cgtcattttt       540
     gtggctatga actatcgtct cggggggttt ggttttatgc cgggcgcaga gattcggaaa       600
     gatggctccg cgaatctcgg gcttagggac cagcgtcttg ctttgcaatg ggtcgctgac       660
     aacatcgctg catttggagg cgatccatct aaggtcacca tttggggtga gtctgctggc       720
     gctatctcgg tgtttgacca gatggccatg tatgacggtg acaatatata caacggtgta       780
     ccgctttttc gcagtgccat catgaactcc ggtagcattg tgcctgcaaa tcccgtcgat       840
     ggcacgaaag gccagactgt atatgatact gttgtgaaga acgctggctg cagtggtgtc       900
     agtgacaccc tcgcatgtct acgccacctg gattatacca agttcctgaa cgctgccaac       960
     tcagtcccgg gcattttggg ttacaattcg gtcgccgagt catatctccc tcgtccggat      1020
     ggcacgatct taactcaatc accggaccaa ctagtcatcc aaggcaaata tgcctccgtg      1080
     ccattcatca ttggggacca agaggatgag ggcactatct ttgctttata ccaaagcaat      1140
     ttgaccacca ccgatgacat cgtcgactat ctccagaatc tatatttctt cgacgcctcg      1200
     cgacagcagc ttgaaagtct cgtcgccact taccaagata tcaaagaaga tggctcaccc      1260
     ttccgcacgg gatcccttaa caactggtac ccgcaatata aacgactggc ggccattctg      1320
     ggtgatctat ctttcaccct cacacgccgg gtcttcctga actacgccaa gaaagtgagg      1380
     ccagatgttc cttcctggtc ttacctctca acctacgacc atggccttcc tttcctagga      1440
     acctttcatg ggtccgatgt tttgcaggtg ttccatggta tccttcaaaa ctatggatcc      1500
     aaagccatac actcatacta cttgtcattt gtgtatgacc aagaccccaa tacaagggct      1560
     tgtgattata tggattggcc acaatgggct aataaccagt cgctgatgga attttccatc      1620
     gaccgtggtg gcctcttgcc ggataacttt cgtcaggata gctataacca gatcatggcg      1680
     gatcctcctg cattctatat ctga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page