(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE66

PENCW_13.PE66        Location/Qualifiers
FT   CDS_pept        join(149167..149461,149516..149650,149707..150298,
FT                   150351..150505,150557..151233)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823849"
FT                   /orf_name="Pc16g00660"
FT                   /product="Pc16g00660 protein"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92736.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI000183123C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W9"
FT                   /transl_table=1
FT                   /translation="MNASDPAEVAEIAKSKAISHNISADEKVPVVDDLTIDNAPPVRAG
FT                   SIEGDDYALEKTAPTDEELATLRRVAGKLPAAAYSVAFVELCERFSYYGTTAVFVNFIQ
FT                   RPLPDQSTTGALVPGVSDWSNESPGALGMGQQASTGLTLFNSFWSYIMPLFGAIVADQY
FT                   WGRYRTIMSAIACALVGHVILIVSAIPQVIENQKGAAACFSIGLVIMGVGTGGFKSNIS
FT                   PLIAEQYTDDRPYVTTLASGERVIVDPAATVARIYLYFYMMINIGSFVGQVAMVYAERY
FT                   VGFWLSYLLPTAMFCLCPAVLLLFKKNYVLTPPSGSIYGKALKVWGLALKGNWSLNPVR
FT                   WFQKSDKDIWAAAKPSHFGDNKPAWMDFDDAWVDEVRRGLMACRVFLWYPLYWLAYNQM
FT                   LNNLTSQAATMKLGGVPNDIINNLNPISLIVFIPIFDHIIYPGIRKMGFHFTPLKRITA
FT                   GFIMAALSMVVAAVTQHYIYKLGPCGSNANHCIEVEKQYTNISVWVQALTYIMGGISEI
FT                   LASVTSLEYAYTKAPKNMRSLVQAVALLMNAFSSAIGQAFIGLAKDPLLVWNYTVVAIL
FT                   AFVGGVGFWATNYKLDAEEDAMNMLPDSSFTPHAAEDEERK"
     atgaatgcca gtgatcctgc cgaagtggct gagattgcca aatccaaggc aatctcccac        60
     aacatcagtg ccgatgagaa agtcccagta gtcgatgacc tgaccatcga caatgcccct       120
     cccgtgagag cagggtcaat cgaaggagac gactatgctc tggaaaagac cgctcctaca       180
     gatgaggaac tggccacttt gcgccgtgtt gcgggcaagc tgcccgcggc agcatacagt       240
     gttgcctttg tggaactgtg cgagcgtttt tcgtactacg gtaccactgc tgttttcgtc       300
     aacttcattc aacgaccctt acccgatcaa tccaccaccg gtgcccttgt cccaggcgtc       360
     tctgattgga gcaacgaatc acctggagct ctgggtatgg gccaacaggc ctctacggga       420
     ttgacattgt ttaactcttt ctggtcctac atcatgcccc tcttcggtgc catagttgct       480
     gatcaatatt ggggtcgtta ccgcaccatc atgtccgcga ttgcctgtgc actcgttgga       540
     cacgtcattc tcatcgtttc cgccattccc caggttattg aaaatcaaaa aggagccgct       600
     gcatgcttct ctatcggtct tgttattatg ggtgtaggga ctggtggttt caagtccaac       660
     atctcgcccc tcattgctga acaatatacc gacgacaggc cctatgtcac aacacttgct       720
     agcggtgagc gtgtcatcgt tgacccagct gccaccgttg ctcgtatcta cctgtacttc       780
     tacatgatga tcaacattgg ttcctttgtg ggtcaggttg caatggtcta cgccgagcga       840
     tacgttggtt tctggctctc ttatcttctg cccaccgcca tgttctgtct ctgcccggcg       900
     gtattgctct tgttcaagaa aaactacgtc ctcactcccc ctagtggatc gatctacggc       960
     aaggctttga aggtgtgggg tttggcgcta aagggcaact ggagtctgaa ccccgtgcga      1020
     tggttccaga aatctgataa ggatatttgg gccgccgcca agcccagcca ctttggggac      1080
     aacaagcccg cctggatgga cttcgacgat gcctgggtgg atgaagttcg acgaggactg      1140
     atggcctgca gagtgttctt gtggtacccc ctttattggc tcgcctacaa ccagatgttg      1200
     aacaacctga cgtctcaagc ggccaccatg aaacttggag gtgttcccaa cgacatcatc      1260
     aacaacctca accccatttc actgatcgtc ttcatcccca tcttcgatca catcatttac      1320
     ccaggtattc gcaagatggg tttccacttc acccctttga agcgtatcac ggccggtttc      1380
     attatggccg ccctcagtat ggtcgttgct gcggtcaccc aacactacat ctataagttg      1440
     ggaccctgcg gtagcaatgc caaccactgc atagaggtgg agaagcaata caccaatatc      1500
     tccgtttggg ttcaagcctt aacctacatc atgggtggta tttccgagat ccttgcatct      1560
     gtgacttccc ttgagtatgc ctacaccaag gccccgaaga acatgcgttc cctcgtgcag      1620
     gctgtggcgc tgctgatgaa cgccttctcg tctgccattg gtcaggcttt cattggtctg      1680
     gctaaagacc ctctgttggt ttggaactac acggtggttg ctatccttgc cttcgtgggc      1740
     ggtgttggat tctgggccac caattacaag ttggacgcag aggaggatgc catgaacatg      1800
     ttgccagaca gcagcttcac tccccatgcg gctgaggatg aggagcggaa gtga            1854
//

If you have problems or comments...

PBIL Back to PBIL home page