(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE67

PENCW_13.PE67        Location/Qualifiers
FT   CDS_pept        join(153944..154439,154828..155231)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128158"
FT                   /orf_name="Pc16g00670"
FT                   /product="Putative uncharacterized protein Pc16g00670 "
FT                   /protein_id="CAP92737.1"
FT                   /db_xref="UniParc:UPI000183123D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X0"
FT                   /transl_table=1
FT                   /translation="MTDSQVTKEATAPKKSVTMTRFSAHEKEQMKSGNRTAYVALPKNV
FT                   KAKRATKNDALNKHSVPTERGSPSRVGPSPTTLGALRGSSRRRRKPSRMKYSPTRSNLV
FT                   PRKRFLIEEQMFGNTIGPRKRIVFEKPPGFTKMDVLFREFYHQVLARGLVGPVPLLPVP
FT                   AHRYKSLTMTRFSANEKEQMKAGNRTAYVALPKNLKARRASKNDALNKHIWRTYKKLEL
FT                   EAVLQSGDSYFAVVLKTPENRDRALETLRAKKVRLDSEVVSLQVMPFGVPDEAANTVWT
FT                   VRGWYGDTAEKIAGAIRT"
     atgacggatt cccaggtcac aaaggaagcc accgccccca aaaagtcggt gaccatgaca        60
     cgattctctg cacatgaaaa ggagcagatg aagtctggca accggacggc atacgtagca       120
     ctgcccaaga acgtgaaggc taaacgggct acgaaaaatg atgcgcttaa caagcactcc       180
     gtcccgacgg agaggggaag ccccagccgt gtagggccga gccctactac actaggggcc       240
     ctacgaggtt cgtcacggag aagacggaag ccatcccgaa tgaagtactc gcccacaaga       300
     tcgaacctgg tcccgaggaa gcgatttttg atcgaggagc agatgttcgg gaacacaatc       360
     ggcccccgaa aaaggattgt gttcgagaag cccccgggct tcacgaagat ggatgtgcta       420
     tttcgggaat tttatcatca agttctggcc agaggacttg tcggccccgt gccacttctg       480
     ccagtcccag cacacaggta taagtcactg accatgaccc gtttctcggc gaacgagaag       540
     gagcaaatga aggccgggaa cagaacggcc tatgtggcac taccaaagaa tctgaaagct       600
     aggcgtgcaa gcaagaacga tgcgctcaac aagcacatct ggcgcaccta taagaagctg       660
     gagctggaag cggtgcttca atctggggac tcatactttg cggtagttct taagacgccg       720
     gagaacagag atcgggccct agaaacactg cgtgccaaaa aggttcgcct ggattcggag       780
     gtggtgtcct tgcaggtgat gccgttcggt gtcccggacg aggccgcgaa cactgtttgg       840
     acggtccgag gttggtatgg tgacaccgct gaaaagatcg ccggtgcgat ccgaacctag       900
//

If you have problems or comments...

PBIL Back to PBIL home page