(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE68

PENCW_13.PE68        Location/Qualifiers
FT   CDS_pept        join(157270..157357,157411..157904,157967..158308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945533"
FT                   /orf_name="Pc16g00680"
FT                   /product="Pc16g00680 protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP92738.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000183123E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X1"
FT                   /transl_table=1
FT                   /translation="MTGPMICRVLAVLSLGMIVNASPVQLARRAISSELLERFTLFSQF
FT                   AALSACDQNINHTGQSLTCDYGTCPLVAADNTTVINAFHSDHGPTGYIALDHTRELIVL
FT                   AFRGTVSKSDGDTDLDIALTPIDEVCTGCRAHHGFWVYWSAVASQATSRLRDATSAYPG
FT                   YTLSVVGHSLGGGISALAGTVLRTQGFNLDIWTFGGPKPGNMKLAEFITNQQAPNSIYR
FT                   ATHTTDPIPKVPINLPFLDWSQPSPEYWITQATGVQVTPDGVQYVEGINSKEGNAGSDR
FT                   DLRWPNPEHGWYFGNMSACATPIDAS"
     atgaccgggc caatgatttg tcgagtgctt gcggtactat cactcggcat gatagtcaat        60
     gcatctccag tccaactagc tcgccgggca atctcaagtg aactattgga acgattcacc       120
     ctattctccc aattcgccgc cttatccgcc tgcgatcaaa acatcaacca cacgggccaa       180
     agtctgacct gcgactacgg cacctgcccg ctcgtagcag ccgacaacac gacagtaatc       240
     aatgcattcc acagcgatca cggcccaaca ggctacatcg ccttggacca cacgcgggaa       300
     ctgatcgtcc tagcattccg cggaacggta tccaaaagcg acggcgacac agatctcgat       360
     atcgccctca ccccgattga cgaggtgtgc accggatgca gggcccatca tgggttctgg       420
     gtttactgga gcgccgtagc gagccaggca acatctcggc ttcgcgatgc aaccagcgcg       480
     tatccgggat atacgttgag cgttgtagga cacagtctgg gcgggggtat ttcggcgcta       540
     gcagggacgg tccttcgaac acaggggttc aacctggata tttggacatt tggaggcccc       600
     aaacctggaa acatgaaact ggccgaattc atcactaacc agcaagcgcc caacagcatc       660
     taccgagcca cgcatacgac agaccccatc ccgaaagtgc cgatcaatct gccattctta       720
     gattggagtc agccttcgcc tgaatactgg attactcagg cgactggagt ccaggtcacc       780
     cctgatgggg tgcagtatgt tgaagggatc aatagcaagg aggggaatgc tggttcggat       840
     agggatttga ggtggccgaa tcctgaacat gggtggtatt ttgggaatat gagtgcgtgc       900
     gcgactccga tagatgcatc atag                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page