(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE69

PENCW_13.PE69        Location/Qualifiers
FT   CDS_pept        complement(158480..159982)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000143616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977037"
FT                   /orf_name="Pc16g00690"
FT                   /product="Pc16g00690 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92739.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000183123F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X2"
FT                   /transl_table=1
FT                   /translation="MNGLNGINENHFDVIIVGAGISGINAAYRVQDQLPGYTYTILEAR
FT                   ADLGGTWDLFKYPGIRSDSDLFTFGFQFNPWSRDNPIAEGSAIKQYVRDTAAKYGIDQH
FT                   IRYNHRLSSADWSSDENTWSLSVNHNDSEQTYTARYVIFGTGYYNYKDPLKADIPGLDA
FT                   FQGQIVHPQFWPENLQYKDKKIVIIGSGATAITLLPNLADHAARVTMLQRSPTYILSVP
FT                   NRSASRWLSYLLPNSVYCKLQRMIWIYTTRIFFLFCQRFPNFSRWLLKLNVRKQLPNHI
FT                   PYDPHFKPRYNPWDQRLCVCPDGDLFRSLRQGKADVKTDTIREVTKNGILLNSGEELDA
FT                   DIIITATGLRLQIAGGSALSVDGTKLDIGDKYLWNGVMLQDLPNASFVIGYTNASWTLG
FT                   SDATAQFICRLLKKLESQKSVAAIPRLKEKDAATLQDRPLLNLQSTYVSVAQRTLPKAA
FT                   DRGPWQPRDHYIKDLKFAQSGDIDTGLEFVQGPNLRLRPKMS"
     atgaacggac tcaatggaat aaacgaaaac cacttcgatg tcattatcgt cggtgcaggt        60
     atctccggta tcaacgccgc ttaccgtgtc caagaccaac tccccggcta cacctacacc       120
     atcttagaag cgcgcgctga tctaggtggc acctgggatc tcttcaaata ccctggcatc       180
     cgttccgatt ctgatctttt cacttttggt ttccaattca acccctggtc ccgcgataac       240
     cccatcgccg aaggctctgc tatcaagcag tacgtgcgcg atactgcggc caaatacggc       300
     atcgaccaac acattcgcta caaccatcgt ctgtcatccg cagattggtc ctccgatgaa       360
     aatacctggt cgctctccgt caaccacaat gactccgaac agacctacac cgcccgctac       420
     gtcatcttcg gcacgggcta ctacaattac aaagatcccc tgaaggccga catccccggc       480
     ctggacgcct tccagggcca gatcgtccac cctcagttct ggcccgagaa cctccaatac       540
     aaggacaaga agatcgtgat catcggatcc ggtgcgaccg ccatcactct cctccccaat       600
     ctcgccgacc atgccgcccg tgtcacaatg ctccagcgca gcccaaccta catcctctcc       660
     gttccgaacc gctcagccag tcgctggctc tcctacctcc tccccaattc agtgtattgc       720
     aagttgcagc gcatgatctg gatctacacc acccgcatct tcttcctctt ctgccagcgc       780
     ttcccgaatt tctcccgctg gctgctcaag ttgaatgtgc gcaagcaatt gcccaaccat       840
     atcccctacg acccacattt caagcccagg tataacccct gggaccagcg attgtgtgtc       900
     tgtcccgatg gggacctgtt ccgcagtctc cgacagggca aggcggatgt caagaccgat       960
     acgatccgcg aggttacgaa gaatggtatt ctcttgaatt cgggcgagga gcttgacgca      1020
     gatattatta ttaccgctac tggcttgcgc ttgcagatcg caggtggctc tgctctctct      1080
     gtggacggga ccaaacttga cataggcgat aagtatctat ggaatggagt catgctccag      1140
     gatctgccta atgcctcttt cgttatcggg tataccaacg cctcgtggac tctcggttcg      1200
     gatgcgacgg cgcagtttat ctgccgtttg ctcaagaagc tcgagtcgca gaagtcggtc      1260
     gccgctattc cccgtctaaa ggagaaggat gctgctacac tccaggatcg tcctctcttg      1320
     aaccttcagt ccacttatgt gtcggttgcc cagcgcacgt tacccaaggc tgctgatcgt      1380
     ggtccctggc agccgcgtga tcactacata aaggacttga agtttgctca gagcggtgat      1440
     attgacaccg gactagaatt cgtgcaaggg ccgaatctgc gtctgcgtcc taagatgtcc      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page