(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE70

PENCW_13.PE70        Location/Qualifiers
FT   CDS_pept        join(160585..160948,161013..161737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977038"
FT                   /orf_name="Pc16g00700"
FT                   /product="Pc16g00700 protein"
FT                   /protein_id="CAP92740.1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0001831240"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X3"
FT                   /transl_table=1
FT                   /translation="MSITKITKVTKVKLSLKEKLDFFPAVVSIVIAYIYALLTGLRRSE
FT                   RQAKSLSLHLGYAVFRKATARLTTTQMQYILPPSHKIYERHSKKTGRLPESVELGDGAL
FT                   GHWVGDRNADNVLVWFHGGGFGLPANMGYFKFYAQLLRDLKASGKSVAVFSLTYTLAPI
FT                   AVYPTQLRQAVNCLRYILSQPNRDPATVFLGGDSAGGNLVGGVLSHLAHPHAEIDSLQL
FT                   HSNLGGAVMIAPWTLLEKDFPEIEIYHGGDIITTAVAGPWSAAYIGAGKRDYYTDLSTA
FT                   PADWFTTFPVNSVLITAGGNEIMLPLIQDFAAKFKEGFENVELFVGHRECHVAPIYHLE
FT                   LGNATKTEQGKKVEAVLAELMV"
     atgtctatca ccaaaataac caaagtaacc aaagtgaagc tctccttaaa ggagaaactg        60
     gacttcttcc cggctgtggt ctccatcgtc atcgcctaca tctatgccct cctcactggt       120
     cttcgacgca gcgaacgcca agccaagtct ttgtcccttc atttgggata tgcggtgttc       180
     cgcaaggcga ccgcgcggtt gaccacgact cagatgcagt acattctacc gccatcccac       240
     aagatctatg agcgacactc caagaagact ggcagactcc ccgagtccgt ggaattgggt       300
     gatggggcat tgggccactg ggtaggcgat cgaaatgccg acaacgtgtt ggtctggttc       360
     cacgggggtg gcttcggact accggctaac atgggctatt tcaaattcta cgctcagctg       420
     ctacgtgacc tcaaagcatc cggtaaaagt gtcgcggtct tcagtctgac ctacaccctg       480
     gcgccaattg cagtctaccc gactcaactc cgccaggctg tgaattgtct gcgatatatc       540
     ctctcgcagc cgaaccgcga cccagccacg gttttcctgg gtggcgactc tgcaggcggg       600
     aatctggttg gtggagtact ctctcacctg gcccacccac acgcagagat cgattccctg       660
     caactgcaca gcaacctggg cggagcagtg atgatcgcac catggacact acttgagaaa       720
     gacttccccg aaatagagat ctaccacggt ggcgatatca tcacgacggc agttgcggga       780
     ccgtggtcgg cagcctatat tggtgcgggc aagcgggact attacactga tctatcgact       840
     gcaccggcgg attggtttac gacgttccca gtgaactcgg tgttgattac cgcgggcggg       900
     aatgagatca tgttgcctct gattcaggac tttgcggcga agttcaagga gggctttgag       960
     aatgtggagt tgtttgttgg gcatcgtgag tgtcatgtgg cgccgattta tcatttggag      1020
     ttgggaaatg ccacgaagac agagcagggg aagaaggttg aggctgtgtt ggccgaattg      1080
     atggtgtga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page