(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE71

PENCW_13.PE71        Location/Qualifiers
FT   CDS_pept        join(complement(162368..163086),complement(162027..162312))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945534"
FT                   /orf_name="Pc16g00710"
FT                   /product="Pc16g00710 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92741.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831241"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X4"
FT                   /transl_table=1
FT                   /translation="MSTLNLITQYTQTALSHLPEPAQDLLHHPTAQKAIGVLAALTLLR
FT                   ITNRFLSKRTLQNWTSNQPWIPARELILLTGGCSGIGKQVMEDLARTGVRVIILDINEP
FT                   TFSLPANVTFYKANITSSADIAQVANTIRENHGDPTVLVNNAGIGHEGTILDEPEEKIR
FT                   QTFEVNTLSHFLMVKEFLPAMVKANHGHVVTIASMASFVALGEIVDYCCSKASALAFHE
FT                   GLRQELKYWYNAPNVRTSVVHPFWVRTPMIKMLTDHEAHLKQPIMTPQVVSDAICKQIL
FT                   TQTSGQVILPASQSVARLVRAMPTWMQEGVRTFASGALRRMRIAQQAEKEAQA"
     atgtctaccc tcaacctcat cacccaatat actcaaacgg ctctatcaca cctcccagag        60
     cccgcccaag atctcctcca ccatccaaca gcccaaaagg cgatcggagt tctcgccgcc       120
     ctcaccctcc tccgcatcac aaaccgcttc ctttcaaaac gcaccttgca aaactggacc       180
     tccaaccaac catggatccc agcccgcgag ctcatcttgc taacgggcgg gtgcagcgga       240
     atcggcaagc aggtcatgga agacctagcg cgcacaggag tgcgcgtcat catccttgat       300
     attaatgagc cgactttctc actacctgcc aacgtcacct tctacaaggc gaatatcact       360
     tcctcggctg atattgccca agtcgcgaat accattcgcg aaaaccacgg cgatcctaca       420
     gtcttggtca acaatgcggg cattggacat gaggggacca tcctcgatga gcctgaagag       480
     aagattcgtc agactttcga ggtcaatacc ctctcccatt tccttatggt gaaggagttc       540
     ttgccggcca tggtgaaggc gaaccatggt catgtcgtca ctattgctag tatggcgagc       600
     tttgtggctc tcggtgagat cgtggattat tgttgctcca aggctagtgc gcttgctttc       660
     cacgagggcc tgcgtcagga gttgaagtat tggtacaatg cgcctaatgt gcgcactagt       720
     gttgttcacc ccttctgggt acgtacgccc atgatcaaga tgctcacgga ccacgaggcc       780
     catttgaagc agcccatcat gaccccccag gtcgtgtccg atgctatctg caagcagatc       840
     ttgacgcaga ctagtggtca ggttattctg cctgccagtc agtcggtggc taggttggtg       900
     cgggctatgc cgacctggat gcaggagggt gtgcgcactt ttgcatcggg tgcgttgaga       960
     aggatgcgta ttgcgcagca ggcggagaag gaggctcaag cgtag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page