(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE72

PENCW_13.PE72        Location/Qualifiers
FT   CDS_pept        join(163768..163887,164023..164462,164524..164908,
FT                   164986..165600)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128159"
FT                   /orf_name="Pc16g00720"
FT                   /product="Pc16g00720 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92742.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0001831242"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X5"
FT                   /transl_table=1
FT                   /translation="MALGDSVLAVGAFTLAEAYFLQRTILTDTTFQRICLSALGGSHVE
FT                   LVFDSPRGTKPLQWMKTVPNEGLIHMRDTFNRSYVIPTNHQALLDVMSTNTYDFEKPWR
FT                   MRNFLARIIGFGMITSEGAAHKKQRKALTPAFNIKNIRSMYSLMWSKTGQLLDELEKEI
FT                   KVQPMDGTGPEDQEGKIEMSEWASRLTLDIIGPIAMGRDFGSLQNKRNKVADSFAKILE
FT                   PTKEKMAFLMMNFALPQWMARRVPWRQNDVLNAETAYLRSTCDEIVREKRASLAGSKVS
FT                   AQDLEADILGTMMLGGDFSDTELVDQMLTFLAAGHETTASALTWACYLLHLHPEYQTRL
FT                   RDEIRSKIPSGNSPITYQDLESLPLLNGVCQEVLRLYPTVPTTIRESVRNTVIAGKYIP
FT                   KGTRVVLCPWAINRSPLFWGENGEEFVPERWIDTDKNGHCIPNNNGGASTNFAQITFLH
FT                   GQRSCIGKDFARAELRCAVAGVVGRFLFEMQDPKQEIHVAGAVTIKPVEGMHLRMRRID
FT                   EW"
     atggcccttg gtgacagtgt actggcagtg ggcgcattca cccttgccga ggcgtatttc        60
     ctccaacgca ctatcttgac agacacaacc tttcagagaa tctgtctcag cgcactggga       120
     ggctcacatg tagaactcgt cttcgactcg ccacggggaa caaaacccct ccagtggatg       180
     aaaaccgtcc caaatgaagg actcatccac atgcgcgaca cgttcaatcg aagctacgtg       240
     atcccaacca accaccaagc cctgctagat gtcatgagca cgaacacata cgactttgag       300
     aagccatggc gaatgcgcaa tttcctcgca cggatcatcg gcttcgggat gattacctct       360
     gaaggcgcag cgcacaagaa gcaacgcaaa gcactcacgc ccgcgttcaa cattaagaat       420
     atacgttcga tgtattcgct catgtggagc aagacgggac agttactgga tgagctcgag       480
     aaagaaatca aggtccaacc gatggatgga acgggtccag aggaccaaga gggtaagatt       540
     gagatgtccg agtgggcgag ccgcctcacc cttgacataa tcgggcctat agcaatggga       600
     cgtgactttg gctcgcttca gaacaagcga aacaaggtgg cagatagctt cgcgaagatc       660
     ctcgagccga ccaaggagaa gatggcgttt ctgatgatga actttgcgtt gccgcagtgg       720
     atggcgaggc gtgtgccctg gcgacagaat gacgtactga atgcggagac ggcgtatcta       780
     cgcagtacct gcgatgagat tgtgcgcgaa aagcgagcca gtcttgctgg atccaaggtt       840
     tccgctcagg atctcgaggc tgatattctg ggaacgatga tgcttggcgg ggatttctcg       900
     gatacggagt tggttgatca gatgttgaca tttttggccg ctggacacga aaccaccgcc       960
     agcgccttaa cctgggcctg ctatctcctc cacctgcacc cagaatacca aacccgcctc      1020
     cgagatgaga tccgctccaa gatcccatca ggcaatagcc cgataaccta ccaggatctc      1080
     gaatcgctcc ctttactaaa cggcgtctgt caagaagttc tccgtctgta cccaacggtt      1140
     ccaaccacaa tccgcgaatc agtccgcaac accgtcatag cagggaagta catcccgaaa      1200
     gggacacgag tggtgttgtg tccgtgggcg atcaatcgga gcccgctctt ctggggcgaa      1260
     aacggggagg agttcgtacc ggagcgctgg atcgacacgg acaagaacgg gcactgtatc      1320
     ccgaacaata atggcggggc gtcgacgaat ttcgcgcaga ttacgttcct gcatgggcag      1380
     agatcttgta ttgggaagga ctttgcgcgt gcggagttgc ggtgtgcggt tgctggtgtt      1440
     gttggccggt ttttatttga aatgcaggat ccgaagcagg agatccatgt tgctggggct      1500
     gttactatta agccggttga ggggatgcat ttgaggatgc ggaggattga cgagtggtaa      1560
//

If you have problems or comments...

PBIL Back to PBIL home page