(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE73

PENCW_13.PE73        Location/Qualifiers
FT   CDS_pept        join(complement(167388..167600),complement(166819..167313),
FT                   complement(165956..166756))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671095"
FT                   /orf_name="Pc16g00730"
FT                   /product="Pc16g00730 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92743.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831243"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X6"
FT                   /transl_table=1
FT                   /translation="MEKADSQHQHIESANSNQMESGKQCDFYVEDRITHLSEGHRQYIL
FT                   AKHGTLDLEPIPDMTDTDPYNWPQWRKNLNLTLVAFHAMMGTFTASSIQSVFENISEDL
FT                   DVSMQRTSYLVSLFIAVLGGAPLFWRPLCNRYGRRPIFLISLICSLVGNVGCAKSPSYA
FT                   TMGLCRAITAFFISPAAAIGSAVVAETFFRKDRARCMGAWTVMVTLGVPAAPFIFGFVA
FT                   LRVGYRWIYYILAIVNAVQFVLYFFFGSESLYVRSNVPPDNVIAAKRSLFRFRRIDPTP
FT                   LKLWDFFQPLIYVMKPCVIIPAVAYAMIFLWGGIVLTIEISQVYPAKFGLNTQQVGLQF
FT                   LGIIIGSVVGEQIGGFISDRWMLIRQKRTGEPSPPEYRLWLSYIGHALTICGIVVFAIE
FT                   IRDSGGAWTIAPVIGTAIGACGNQIVTTVDITYAVDCYREDAASVGVFITFVRQTWGFI
FT                   GPFWFPEMFEIVGWAGGAGIAVALIVGVSVIPTILVQWRGAGWR"
     atggagaagg cagatagcca acaccagcac attgaaagcg caaattctaa tcaaatggag        60
     tctggaaagc aatgtgactt ctacgtcgaa gaccgaataa cccatctatc cgagggacac       120
     cgtcaatata ttcttgcgaa gcatggaacg ctcgatctag agccaattcc tgacatgacc       180
     gatactgatc catacaattg gccgcaatgg aggaaaaact tgaacttgac cctagtcgcc       240
     ttccacgcca tgatgggcac attcactgcc tcgtcaatcc aatctgtatt cgaaaatatc       300
     tccgaagacc tcgacgtcag tatgcagcgg accagctacc tcgtctctct cttcattgcc       360
     gtgctaggcg gcgcgcctct cttctggcgc ccgctgtgta atcggtatgg ccgacggccc       420
     atcttcctca tctcgttgat ctgcagcttg gttggaaatg ttggctgtgc gaagagccct       480
     tcctatgcaa ctatgggtct ctgccgtgct attactgcct tctttatcag ccctgcggct       540
     gctatcggta gcgccgttgt tgcggagact ttcttccgga aagatcgtgc tcgatgcatg       600
     ggcgcgtgga ccgtaatggt caccctgggt gttcctgctg ctccgtttat ctttgggttc       660
     gtggctttgc gtgtgggcta tcgttggatt tattatattc ttgcaatcgt caacgcagtc       720
     cagtttgtcc tctacttctt cttcggatcg gaatccctct atgtccgcag caacgtcccc       780
     cctgacaacg tcatagcagc caagcggagt cttttcagat tccgccgcat cgaccctaca       840
     ccgttgaaac tttgggactt cttccagccc ttgatctacg tgatgaaacc atgcgtgatc       900
     atcccagccg tcgcctacgc aatgatcttt ctctggggcg gtatcgtact cacgatcgag       960
     atctcccagg tctaccctgc caagttcggc ctcaacaccc agcaggtcgg tctgcaattt      1020
     ctgggtatta ttatcgggtc tgtcgttggt gaacagatcg gcgggtttat ttccgatcgt      1080
     tggatgctta tacgtcagaa gcggactgga gaaccatctc cgccggaata ccgtctttgg      1140
     ttgagttata tcggccatgc tttgacgatc tgtggtattg tggtttttgc tatcgagatc      1200
     cgggattctg gcggtgcatg gactattgcc cccgttattg gcaccgctat tggcgcttgt      1260
     ggtaatcaga tcgttactac tgttgacatt acttatgcgg ttgattgtta ccgcgaagat      1320
     gctgccagtg tcggtgtttt tattaccttt gttcggcaga cttggggatt cattggtcct      1380
     ttctggttcc ctgagatgtt cgagattgtt ggatgggctg gtggtgctgg cattgccgtt      1440
     gctctcatcg ttggtgtcag tgtcattccg actatcttgg tgcagtggcg aggagcaggc      1500
     tggcgttga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page