(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE74

PENCW_13.PE74        Location/Qualifiers
FT   CDS_pept        join(complement(169525..169866),complement(169309..169476),
FT                   complement(169080..169253),complement(168781..169026),
FT                   complement(168345..168728))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946580"
FT                   /orf_name="Pc16g00740"
FT                   /product="Pc16g00740 protein"
FT                   /function="polygalacturonase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="CAP92744.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI0001831244"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X7"
FT                   /transl_table=1
FT                   /translation="MKFLAIGALLLSTVSALATEHIIKGAQIIPASDKAGLKKIGAHGH
FT                   HKHHDRRTVTIRSSKSDTDDISDDFLWGIKAANHGGRLLLQKGKTYVIGKKLDLSFLDD
FT                   IEVQLEGEVKFTDDIDYWQANHFYYSFQRSITFWVWGGQDIKIFGKGTLNGNGQEWYNA
FT                   FAGMEILDPDNVFYRPVLFVTDNATRVSVEGITQLNSPCWTNFFVRTKDVSFDDVYINS
FT                   FSTNASALPKNTDGFDSFNVDGLRVTNTRVDVGDDCFAPKPNTTNIFVQNLWCNNTHGV
FT                   SMGSIGQYPGVEDIIEHAWIENVTLVNGQNGVRLKAWAGPDVGFGRINNITYKDVRVEN
FT                   TDSPIVLDQCYFNIDAATCAEYPSSVNFTNINFENIYGTSSGKNGKVVADLTCSPNSVC
FT                   TDIHLSDIDITSPAGGPPIVTCDGIDGDVGVECQSSSA"
     atgaagttcc tcgctatcgg tgcgctcctg ctcagcacag ttagtgctct tgcgacagag        60
     catattatca aaggtgccca gatcatcccg gccagcgata aagcaggtct gaagaagatc       120
     ggcgctcatg ggcatcacaa gcaccacgac cgtcggacag tgacaatccg gtcatcgaag       180
     agcgacaccg atgatatttc ggatgacttc ctttggggaa tcaaggccgc caaccacggc       240
     ggcagacttc tcttgcaaaa ggggaagacc tatgtcattg gcaagaagct cgatctcagc       300
     ttcttggatg atatcgaggt acagctggag ggtgaagtga agttcaccga cgatatcgac       360
     tactggcaag caaaccactt ctactactct ttccagagat ctatcacttt ctgggtgtgg       420
     ggtggtcagg acatcaagat cttcggaaag ggtactctca atggcaatgg tcaggagtgg       480
     tacaatgcct ttgctggcat ggaaattctg gacccggata acgtcttcta ccgtcccgtt       540
     ctgttcgtga ctgacaacgc tacccgcgtg tctgtcgagg gtatcaccca actcaactcc       600
     ccctgctgga ccaacttctt cgtccgtacc aaggatgtct ctttcgatga tgtctacatc       660
     aactcctttt ccaccaacgc atctgctttg cccaagaaca ccgacggatt tgactccttc       720
     aacgtggacg gtctccgtgt gaccaacacc cgcgtcgatg tcggcgatga ctgcttcgcc       780
     cccaagccca acaccaccaa cattttcgtg cagaacttgt ggtgcaacaa cacccacggt       840
     gtcagcatgg gaagtatcgg acagtacccg ggagtcgaag atatcatcga gcatgcctgg       900
     attgagaacg tgaccctggt gaacggccag aacggcgttc gtctcaaggc ctgggctgga       960
     ccggacgtcg gctttggtcg catcaacaac atcacataca aggatgttcg cgtcgaaaac      1020
     accgactccc ctatcgtgtt ggatcagtgc tacttcaaca tcgacgccgc cacctgtgcc      1080
     gaatacccgt cgtcagtcaa cttcaccaac attaacttcg agaacatcta tggcacctcg      1140
     tcaggcaaga atggcaaggt tgtcgctgac ttgacttgct cgcccaattc tgtgtgcacg      1200
     gatatccatc tctccgatat cgatattact agcccggctg ggggtcctcc catcgtgacc      1260
     tgcgatggaa ttgacggaga tgttggtgtg gagtgccagt caagctcagc ttag            1314
//

If you have problems or comments...

PBIL Back to PBIL home page