(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE75

PENCW_13.PE75        Location/Qualifiers
FT   CDS_pept        join(169977..170051,170143..170487)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824068"
FT                   /orf_name="Pc16g00750"
FT                   /product="Putative uncharacterized protein Pc16g00750 "
FT                   /protein_id="CAP92745.1"
FT                   /db_xref="UniParc:UPI0001831245"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X8"
FT                   /transl_table=1
FT                   /translation="MAPTLFPRLPMSGERHGQGEEISPPAMESFLRISPRVSDKREDAE
FT                   RQDEPNELRRWVIQIPNCYGRVLWPGFIFPRLGLISAWRVGFFHQSAAQFVIQRSRRGL
FT                   AVFPGWGDCRGLLSSGFQFSLDIVFVVAGAQSWME"
     atggcgccca cgcttttccc cagattacca atgtccgggg aacggcacgg gcagggggaa        60
     gagatttctc cgcctgcaat ggagtcattt ctccgcattt cgccaagggt atcggataag       120
     cgggaggatg cggagagaca ggatgagcct aacgagctca ggcgttgggt tattcagatt       180
     ccaaattgtt atggccgagt gttatggccg ggattcatat tcccccgtct ggggctgatc       240
     tctgcctgga gggttgggtt cttccaccaa tcagcggcac agttcgtcat tcaacgttct       300
     cgtcgtggtc tcgcagtttt tccaggctgg ggggactgtc gaggcctcct ttcttccggt       360
     tttcagtttt cgttggatat tgtgtttgtc gtggctggcg cccagtcttg gatggagtga       420
//

If you have problems or comments...

PBIL Back to PBIL home page