(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE79

PENCW_13.PE79        Location/Qualifiers
FT   CDS_pept        join(complement(181204..181800),complement(179358..181154))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977299"
FT                   /orf_name="Pc16g00790"
FT                   /product="Pc16g00790 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92749.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831313"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y2"
FT                   /transl_table=1
FT                   /translation="MENNDHSSLDHEEIESQSRTTQRRRRPPLSCTVCRKRKLKCDRSL
FT                   PCRQCVRSKTTAQCVFVGTQPGIVSDSSQRMSPPQLPYGGGEEQPGRKSGMFVFDSKLG
FT                   PNPTSNRVSKRGRSDELSELRSRLRVLETSLGKPSHLQTPETSVCDVFSEVDTANSSEN
FT                   VGVDDRVRYLPDSSFRGKKAKTRYFGRSHYTTTVSFFKDIGAFMRRDRCRGEGKDKEYT
FT                   EMKKFKTELWSRETQDHQRAFREQAFKLNEMVPQRNVADHLLQLYLDTFETTYRILHTP
FT                   TFLRQYADYWANTQPTDMAFVAQLLAVMAAGSCFYVPRPGQDDRDIFQKPAMKWIMAVQ
FT                   SYISCTFVSPDIDFRMLQTQTLLLVARLGVASDGDVAWASAGSLIRSAMTMGLHRDPTR
FT                   FRKARPFYSELRRRLWATVVELDLKISLDRGVPPSVDLDECDCDPPSNWDDSDLIPDME
FT                   NDPSPLSTALYTQNFYQTLLIKTLPLRYRIAKKINSLRFNLSYDDALRMGDELSRSIQR
FT                   ASSLFEDNAPSIAPGESGRHRFAQSIHLFIMRKFLLALHRPFSLSVVRLPKCSYSRKIC
FT                   LEESLGILSQMELPLSTEDVLYPHITQLGSGMFCDETFHAAITACVELSLQANEMSASA
FT                   TSGMDGVNSSVLMSMIQSQQGVMMQAVERTADNFGRRIGPDGKGCKPFFFLNIILASVK
FT                   SRVKGEDPLCNVDTASKRSIRICRAILNGLTYQEAKISVDNRPFQVGTSVCRYVSVIPN
FT                   VPVQTSVPSGTTPASKTPSDIDPASLLSTDFSDFTVGYCSSDAV"
     atggaaaaca acgaccactc ctccctagac catgaagaga tagaaagtca atctcgcact        60
     acacagcgtc gccgccgccc gcctctgtct tgtacagtct gtcgcaagcg caagttaaaa       120
     tgtgaccgct ctctgccctg cagacaatgt gtgcgctcaa agacaacagc ccaatgcgtc       180
     tttgtcggaa ctcagcctgg tattgtatct gactcttctc aacgcatgtc ccccccgcaa       240
     ttaccctatg gtggcggaga agaacagccc gggcggaaaa gcgggatgtt cgtcttcgac       300
     tcgaaattgg ggccgaatcc gacttcaaat cgtgtttcga agcgtggtcg ttccgatgag       360
     ctgagtgaac tccggagtcg gctgcgtgtt ctggaaacct cgctcggaaa gccgtctcat       420
     cttcagacgc ctgagacttc ggtctgtgat gtcttttctg aagtcgatac ggccaatagt       480
     tctgagaatg ttggtgttga tgaccgcgtc cgatacttgc cagattcgag tttccgcggg       540
     aagaaggcta agactcgtta tttcggtcgc agccattata ccactactgt ttcttttttc       600
     aaagatattg gtgcctttat gcgccgtgat cgttgccgcg gagagggaaa agataaagaa       660
     tatactgaaa tgaaaaagtt caagacggag ctttggtcgc gcgagacaca agatcatcag       720
     cgcgcgtttc gcgagcaggc ctttaagctt aatgaaatgg ttccccagcg gaatgttgca       780
     gaccatctgc ttcagctgta tctcgacact ttcgagacga catatagaat cttgcacacg       840
     ccgacgttct taagacagta tgctgattac tgggccaata cccagccaac cgacatggca       900
     tttgtcgctc agttactcgc cgtgatggct gctggcagtt gcttctatgt cccacgccca       960
     ggccaagatg atcgagacat attccagaaa ccggccatga agtggatcat ggctgtccag      1020
     tcatatattt cgtgcacatt tgtgagcccg gatatcgact tccgaatgct ccagacccaa      1080
     actcttcttc tggtagctcg gttgggagtc gccagtgacg gggatgttgc ctgggcttca      1140
     gccggatcgc tgattcggtc tgcgatgaca atgggtctac atcgtgatcc gactcgtttc      1200
     cgcaaggccc gaccattcta ctctgaactg cgccgtcgcc tttgggcaac tgtcgtcgag      1260
     ctggacctca agatctctct cgaccgcggc gtcccgccgt ccgttgatct agacgaatgc      1320
     gactgcgatc ccccgtccaa ttgggacgac tcagacttga taccggacat ggagaatgat      1380
     ccttctccac tcagtactgc tctctacacc caaaacttct accaaactct cctcattaag      1440
     accctcccac tacgctatcg aatcgccaag aaaataaaca gtctccgatt taatctatct      1500
     tacgacgacg ccctgagaat gggtgatgaa ctctcccgct ctatacagcg tgcatcctcc      1560
     ctattcgaag acaacgcccc aagtattgct ccgggagaat caggacgtca ccgattcgcc      1620
     caatccattc atctcttcat aatgcgcaaa tttcttcttg ctctccaccg ccctttctcc      1680
     ctcagtgtcg tccgcctacc caaatgctcc tactcccgca aaatctgtct cgaagaatcc      1740
     cttggtattc tctcccagat ggaacttccc ctttcgacag aggacgtcct ctacccgcac      1800
     atcacccagc tgggcagcgg tatgttctgc gatgaaacct tccacgccgc aatcaccgcg      1860
     tgcgtggagc tctccctcca agccaatgag atgagtgcat ctgctacatc tggaatggac      1920
     ggtgtcaact cgagcgtgct catgagcatg atccagtccc agcaaggcgt gatgatgcag      1980
     gctgtcgagc gcaccgctga taatttcggg agacgcattg gtcccgatgg gaaggggtgc      2040
     aagccgttct tctttttgaa tattatcctt gcttcggtca aatcgcgcgt caagggtgag      2100
     gacccattgt gtaatgttga tacggcctcg aagaggtcca ttcgcatttg cagggcgatc      2160
     ttaaatggtc ttacatacca ggaggctaag attagtgttg ataatcgccc cttccaggtt      2220
     ggtacctctg tttgtagata tgtgtccgtc atacctaacg ttcctgttca gacttccgtt      2280
     ccttcaggga caactccggc ctcgaaaaca ccgagtgata ttgatcctgc atcgcttcta      2340
     tcgactgact tcagtgattt tacggtaggt tattgttcct cggatgccgt ttga            2394
//

If you have problems or comments...

PBIL Back to PBIL home page