(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE81

PENCW_13.PE81        Location/Qualifiers
FT   CDS_pept        join(complement(188550..188693),complement(188422..188520),
FT                   complement(188202..188352),complement(188047..188124),
FT                   complement(187806..187857),complement(187719..187751),
FT                   complement(187665..187689))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946584"
FT                   /orf_name="Pc16g00810"
FT                   /product="Putative uncharacterized protein Pc16g00810 "
FT                   /protein_id="CAP92751.1"
FT                   /db_xref="UniParc:UPI0001831315"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y4"
FT                   /transl_table=1
FT                   /translation="MAPNSLTLSTSSSPTARPNSFPSFFSPFRFPVPCFPRPSSSSSTT
FT                   PGLSTHNIYPALHRVLPALHVHDPWTSTGAQEDGALSVIEGLHFAEEERGEGEEGKFEA
FT                   ETRSLELGALNWIGKLSWDIILEMRELELLCIICTEEKKTDILLSYHRHLRHQCIRICH
FT                   GRIRVECSISRLLRLASTYLATPYSVNYTG"
     atggccccaa actccttgac actctccacc tcatccagtc ccactgcgag acccaactct        60
     ttcccgtctt tcttctctcc attccggttc ccagtcccct gtttcccacg tccatcctcc       120
     tcctcctcca caacccccgg cctgtcgacg cacaacatct acccagctct ccaccgggtc       180
     cttcccgccc tccacgtaca tgatccctgg acatccaccg gagcgcagga ggacggcgca       240
     ttgagcgtta tagagggttt gcattttgcc gaggaagaaa ggggagaggg agaagaaggg       300
     aaattcgagg ctgaaactcg gagcttggag cttggggcgc taaactggat tgggaaattg       360
     agttgggata taatcttgga gatgagagag cttgaactac tctgtatcat ctgtacggag       420
     gagaagaaga ctgatatttt attgtcatat catagacacc tgaggcatca atgtatacgt       480
     atatgccatg gccgtattag ggtagaatgt agtatatcta gattacttag attggctagt       540
     acctacctag ctactccgta ctccgtaaat tatacgggtt ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page