(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE82

PENCW_13.PE82        Location/Qualifiers
FT   CDS_pept        join(complement(189752..190220),complement(189043..189683),
FT                   complement(188951..188989))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946585"
FT                   /orf_name="Pc16g00820"
FT                   /product="Pc16g00820 protein"
FT                   /protein_id="CAP92752.1"
FT                   /db_xref="UniParc:UPI0001831316"
FT                   /db_xref="UniProtKB/TrEMBL:B6H700"
FT                   /transl_table=1
FT                   /translation="MPPNKPTFPYRRSSNASEDDFFDIPDEPCLSIVKRQLRHVRTWIA
FT                   VALIILFILWQRRERPPPPPLPHIHYDEVDWSRFAYTQYATNEVYMCNCLMVFEALHRL
FT                   GSKADRVLFYPEEWDLIVEDDYDRVSQLLLEAKLKYNVMLIPIKIEGVQDPSTAGSRAS
FT                   WDTSTAKLMAFGEHEYDRVIHLDSDVILLQTMDELFFLPPTTAAMPRAYWLLPEKLLSS
FT                   LLVVIEPSLREYLALTDATTLAQNGQVDMNLTDHRYDMELLNRRYGDSAMVLPHRQYGL
FT                   LSGEFRKKDHRNFLGNDDEVWDPDHVLAQAKFVHFSDWPLPKPWIMWPQEMLAEEQPKC
FT                   DNNPGTPQESGCRDREIWKMLYDKYRRQRKDVCKLLSYPAPV"
     atgccgccta ataaacccac cttcccttac cgacggagct ccaatgcttc ggaagatgac        60
     ttctttgaca tccccgacga gccctgtctc tccatagtca agcgacagct acgacacgtc       120
     cgaacatgga tcgcagtcgc ccttatcata ctgtttatcc tgtggcaacg ccgtgaacgt       180
     cccccgccgc cgcccctacc acatatccac tacgacgagg tcgactggtc gcgctttgcc       240
     tatacccagt atgccaccaa tgaagtctac atgtgcaact gcctgatggt cttcgaggct       300
     ctgcacagac tcggcagtaa ggcggaccgt gtgctatttt atccggagga gtgggacctc       360
     attgttgagg atgattatga tcgcgtcagc cagttgctgc ttgaggctaa actcaagtac       420
     aatgtgatgc tgatcccgat taagatcgag ggagttcagg atccatcgac tgccggttct       480
     agggcttcgt gggatactag caccgccaag ctcatggcct tcggcgagca cgaatacgac       540
     cgcgtcattc acctcgactc ggatgttatc ctcctccaga cgatggatga gctcttcttc       600
     ctcccgccta ccactgccgc catgccacgt gcctactggc ttctcccgga aaaactgctc       660
     tcatcactgt tagtcgtcat tgagccctcc ctccgggaat accttgcctt gaccgacgct       720
     actacactcg cccagaatgg tcaagtcgat atgaacctga cggaccaccg gtatgacatg       780
     gagctgttga atagacgtta cggggactcg gcgatggtcc tcccccatcg gcagtatggt       840
     ctgttgagcg gcgagttccg gaagaaggat catcgcaatt tcctggggaa tgatgacgag       900
     gtttgggatc ccgatcatgt actggcgcag gctaagtttg tgcacttttc ggattggccg       960
     ttgccgaagc cgtggattat gtggccccag gaaatgttag cagaggagca gccgaagtgc      1020
     gataataacc ctggcacgcc gcaagagagt ggatgtcggg atcgggagat ttggaagatg      1080
     ttatatgata aatatcggag acaacgaaag gatgtctgca agctgctcag ctatccggcg      1140
     ccggtttga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page