(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE83

PENCW_13.PE83        Location/Qualifiers
FT   CDS_pept        join(complement(193534..193573),complement(193440..193465),
FT                   complement(193209..193381),complement(192887..193157),
FT                   complement(192731..192839),complement(192461..192675),
FT                   complement(192339..192406),complement(191856..192267),
FT                   complement(191452..191568))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128402"
FT                   /orf_name="Pc16g00830"
FT                   /product="Pc16g00830 protein"
FT                   /protein_id="CAP92753.1"
FT                   /db_xref="UniParc:UPI0001831317"
FT                   /db_xref="UniProtKB/TrEMBL:B6H701"
FT                   /transl_table=1
FT                   /translation="MDIPNPGEGDVNIGTSTFQACWILTAIVGVALLFRYAIKIWVRWA
FT                   LPEVTAPGRIWGTEDLLFFVAWGFDITHMVFIQMSANWGLGRHFFYLTAEERLNSMKWD
FT                   FLSQPLAVASAMVSRAGMMWFLLTCFAASDKKIRLSIIICAVVQVVVNMVTIVQIIVQC
FT                   GPNPYQTTNRVQYFHYMWTPLPEDGSVKCQSPTVQTTVGFVQGGFNTVIDYFLAVLAAV
FT                   ELWQFFLRTLHRNPETSFWSQFCKISATVRSRRIWQTITLSGPLILSGCASIVKTYKLK
FT                   SLGDRHDFTYNIVTFVLWVNILLASCAPVARLFLRSFVDHRREGRTHGYWSRSRSTDHK
FT                   EPETELKRRANAKEQWLDSATATNMTITCAHDEENPPTGWSEHGHERSISQVSKAEMPE
FT                   HIDDGRVTVKTDIVVQIDDGRSISSGGTRLLPDGGESHSYRAPVNDTQQAANSVYMIIS
FT                   DQARLLSSSSLWAKGVIE"
     atggatattc cgaacccagg tgagggcgat gtcaacattg gaactagcac attccaagct        60
     tgctggatcc tcacagccat cgtcggcgtg gcattgttgt tccgatatgc catcaagatc       120
     tgggtgcgct gggctttacc tgaagtcact gcacccggcc gaatctgggg cacagaggat       180
     ttgttattct ttgtggcgtg gggttttgat attacccata tggtatttat tcaaatgagt       240
     gctaattggg gccttgggag gcatttcttc tatctgactg ctgaagagcg tcttaattct       300
     atgaaatggg acttcctttc acagccactg gctgtcgcct cggcgatggt ctcacgcgcc       360
     ggcatgatgt ggtttctttt aacctgcttt gccgcgagcg acaagaaaat tcgcctatct       420
     atcattatct gtgctgttgt gcaggttgta gtcaacatgg ttacaatcgt ccagattatt       480
     gttcagtgtg gaccaaaccc gtatcagacg actaatcgag tgcaatactt ccactatatg       540
     tggacaccac tccctgaaga tggctccgtc aagtgccaat caccgactgt ccagacgacg       600
     gttgggtttg tgcaaggagg gttcaacacc gtcatcgatt acttccttgc cgtcctcgct       660
     gctgtcgagc tgtggcagtt cttcttgcgg accctccacc gtaatccaga aacctcattc       720
     tggtcccaat tctgcaagat tagtgccacc gtccgatccc gccggatctg gcagaccatc       780
     actctcagtg gaccactgat cctctccggc tgtgcttcta ttgtaaagac ctataaactc       840
     aagtccctcg gtgacaggca tgacttcacc tataacatcg tgacctttgt cctctgggta       900
     aacattcttc tcgcctcctg cgccccagta gcccgcctct tcctccgctc cttcgtcgat       960
     cacagacgcg aaggtcgcac ccacggctac tggtctcgct cccggtcaac ggaccataaa      1020
     gagccagaaa cagagctaaa acgccgtgcc aatgcgaagg agcagtggct ggattcggct      1080
     acggcgacta acatgaccat tacttgtgct cacgatgagg aaaatccgcc gactgggtgg      1140
     agtgaacatg ggcatgagcg ctcgataagt caagtttcga aggcggagat gccggagcat      1200
     attgacgatg ggcgcgttac tgttaaaacg gatattgttg tccagattga tgatgggagg      1260
     tcgatttcct cgggtgggac gaggttgtta cctgatgggg gtgagtctca ttcttaccga      1320
     gcacctgtaa atgatactca acaggcagct aactcggtgt atatgataat ttccgatcaa      1380
     gccaggctac tgagtagttc aagcctatgg gcaaaaggcg tgatagagtg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page