(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE84

PENCW_13.PE84        Location/Qualifiers
FT   CDS_pept        join(complement(195792..195887),complement(195594..195741),
FT                   complement(195526..195540),complement(195334..195460),
FT                   complement(194477..195257))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946586"
FT                   /orf_name="Pc16g00840"
FT                   /product="Pc16g00840 protein"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAP92754.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="UniParc:UPI0001831318"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z8"
FT                   /transl_table=1
FT                   /translation="MPLLTRLASLLGLSSPAPAVPPGAALAATVTVPASLGFVPVAIHF
FT                   DLFNILVSHGGPATADEISATCNARIKARGENEPELSTRLASDTLYIMAGLGLVERVAE
FT                   DCFTANAITNHMVAMPSAQHGALHFTTEGLMAGAFLMKKLQDTRFAYPFADADGPLQYA
FT                   YRLMGQPELAEQHTYSIMETQGRMDSFNHFMVGKFLKFGTFPERVKSMGYDLDAALAGD
FT                   NSTGTRTGSATMVDIGGGRGELLLEVQAMYPHLGAEDLIVQEFNADIDSVPGVRLMEWN
FT                   YKEQDEQPVRGACVYALQHILHNLPDLDAVALLQKISRAMAPGSRVLIIEYAKNLNYTS
FT                   LHASMIALFGGRERSSVEWRQMAGLCGLQVTFEVYVRAGESLVEMRRK"
     atgcctcttc taacccgcct agccagcctc ctgggcctgt catcccccgc ccccgctgta        60
     cctccaggcg ctgccctagc agcaaccgtc accgtacctg catcgttggg atttgttccg       120
     gtcgccattc actttgatct cttcaatatc ctcgtgagtc atggcggacc tgcgacggct       180
     gatgaaatct cggcgacctg caatgctcgt atcaaagccc gaggggagaa tgagccggaa       240
     ttgagtacca gattagcttc ggacacactc tacatcatgg ctggactcgg cctagttgaa       300
     cgcgtggccg aggattgctt cacagcaaac gccatcacga accacatggt tgccatgccg       360
     tctgcccagc atggcgcact gcacttcacc acggaagggc taatggctgg cgcattcttg       420
     atgaaaaagc tccaggacac ccgctttgca tatcccttcg ctgatgcaga cggccccttg       480
     caatatgcct atcggctaat gggtcaaccc gagctggcgg aacagcatac gtactcgatt       540
     atggagaccc aggggcgcat ggatagtttc aaccatttca tggtcggcaa gttcctcaag       600
     tttggaacat tccccgaacg tgtcaagtcg atgggttatg atttagacgc tgcgttggca       660
     ggtgacaata gcactggcac tcgcactggc tccgctacaa tggttgatat cggaggcggt       720
     cgcggcgaac tcctccttga agtccaggct atgtacccgc atctcggcgc ggaagatcta       780
     attgtgcagg agttcaatgc tgacatcgac agtgtgcctg gtgttcggct catggagtgg       840
     aattacaagg agcaggatga gcagcccgtt cgtggagcct gtgtttacgc gctgcagcat       900
     atcctacata acttgcctga tttggatgct gtggcgttac tacagaagat ttcgcgtgct       960
     atggcgcctg gttcgcgtgt gctgattata gaatacgcca agaatttaaa ttatacttcg      1020
     cttcatgcga gtatgatagc attgtttggg ggccgagaga ggagttcggt ggagtggagg      1080
     cagatggcgg gtctgtgtgg gctgcaagtg acatttgagg tttatgttag ggctggcgag      1140
     tcattggtgg agatgaggag aaaatag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page