(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE85

PENCW_13.PE85        Location/Qualifiers
FT   CDS_pept        join(196604..196803,196872..197021,197084..197253,
FT                   197307..197331,197383..197678,197736..197779)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946587"
FT                   /orf_name="Pc16g00850"
FT                   /product="Pc16g00850 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92755.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831319"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z9"
FT                   /transl_table=1
FT                   /translation="MEKPSPVYFTHEMAASASSSLGTHELKECDNNSDVEARDPLNPRN
FT                   WSSARKTMLFVSLMTSSLLADGAMVWGGTLVTDQAMEWDISIAHSATSMNYGILLQGFG
FT                   GIFAVPLIEAYGRLPIWLWPQVITMFMVLGATLSNDWSTFTTFRSLQGLFGTVPQVIGL
FT                   PIIHDMYTSAEWPRMINIWGTTFLVGPFLGPAIAGYIGAGSDWRTSFGVLTAIYGVSTV
FT                   MVILFGYETYHTPGRTTNQSRIASYFGIGNTLLPKGTTLRYWSRTVAVYVFKFPLLMTG
FT                   IAILVTFTWPIGK"
     atggagaaac cctccccggt ctactttaca catgagatgg cggccagcgc atcgtcgtcg        60
     cttgggacac acgagcttaa ggaatgcgat aacaactcgg acgttgaggc cagggatccc       120
     ttgaacccga gaaactggtc ctcggcgcga aagacgatgc tcttcgtatc gttgatgacg       180
     agctcgttgt tggcagatgg ggccatggtc tggggtggaa cactggttac ggaccaggct       240
     atggagtggg atatttccat cgctcattcg gccacgagta tgaattatgg tattctgctg       300
     caggggtttg gggggatttt tgctgttccg cttattgaag cgtatggtcg tttgccgatc       360
     tggctgtggc ctcaggtgat caccatgttc atggtgctgg gtgctaccct ctccaatgat       420
     tggtctacct tcacgacgtt ccgctctttg cagggtcttt ttgggacagt gcctcaggta       480
     attgggcttc cgatcattca tgacatgtat acctcggctg aatggccgcg gatgatcaat       540
     atttggggca ccacctttct cgtcggacca ttcctaggtc ccgccatagc aggatacatc       600
     ggcgccgggt cagactggcg cacctctttc ggagtcctga cagccatcta tggcgtgtcc       660
     acggtcatgg tgatcctctt cggctatgaa acataccata cacctggacg aacgaccaat       720
     cagtcgcgca tcgcgtctta ttttggcatt ggcaataccc tgcttcccaa gggaacgacg       780
     ttgagatatt ggagccgaac cgtcgcggtc tatgtattca agtttccgtt gttgatgact       840
     ggcatcgcta ttttggtaac attcacctgg ccaattggta agtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page