(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE86

PENCW_13.PE86        Location/Qualifiers
FT   CDS_pept        join(197921..198189,198249..198504)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946588"
FT                   /orf_name="Pc16g00860"
FT                   /product="Pc16g00860 protein"
FT                   /protein_id="CAP92756.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183131A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z7"
FT                   /transl_table=1
FT                   /translation="MWYVFSHPRYLRILTIFPGWAFGHFFNGWIFKRHSSTWRTELRLH
FT                   GVWFPIGSLASGLLTYGLTMHFGKHWIGIAIGWIMVNIGMVATIVAISAYALEKYPEKA
FT                   TCVSAILNMWRTCGGFAVGYFQPAWIQRNGLGLVFGIQAAIVCVAVVLTITPVFLWEQK
FT                   RRLRVGDEAEA"
     atgtggtatg tattctcgca cccccgctat ctccggattc tcaccatctt tccaggctgg        60
     gcatttggcc acttcttcaa cggctggatc ttcaagcgcc atagctcaac ctggcgaact       120
     gaactccgcc tccatggtgt ctggttcccg ataggtagtt tggcgagcgg tcttctcacc       180
     tatggattaa ccatgcactt cggtaagcac tggatcggga tagccattgg gtggatcatg       240
     gtgaatatcg gcatggtagc tacaattgtt gccatctcgg cctacgcgtt ggagaaatac       300
     ccggagaagg caacctgtgt ctcagccatt ctgaatatgt ggcgcacctg tggcgggttc       360
     gcggtgggat acttccagcc tgcgtggatt cagcgcaatg ggcttggact ggtttttggt       420
     atccaggctg ctattgtgtg tgtggctgtt gttttgacta tcactcctgt gttcttgtgg       480
     gagcagaaaa ggcggttgag agttggagat gaagctgaag cctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page