(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE87

PENCW_13.PE87        Location/Qualifiers
FT   CDS_pept        join(complement(198994..199132),complement(198771..198907),
FT                   complement(198629..198691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946589"
FT                   /orf_name="Pc16g00870"
FT                   /product="Putative uncharacterized protein Pc16g00870 "
FT                   /protein_id="CAP92757.1"
FT                   /db_xref="UniParc:UPI000183131B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z3"
FT                   /transl_table=1
FT                   /translation="MARNKAKKGSVIAVPEPNQFDTASALIVDNPSSRNDSVEPLNGTN
FT                   GDSCPTGSVIACGTLHSEAMIGCVECWLVGEGSGGEDQGYLIKFEIDGEQRTRTCSDRQ
FT                   PDCGLIVA"
     atggcacgca ataaagccaa aaaagggtca gtgatcgctg tccctgagcc aaaccagttc        60
     gacactgcct cggcgttaat agtggacaat ccatccagca gaaatgattc ggtcgaacct       120
     ctgaacggga caaacgggga cagctgcccc acgggaagcg tcatcgcttg cgggactttg       180
     catagcgagg caatgatcgg ctgcgtagag tgttggttag tgggggaagg ttcaggaggt       240
     gaagatcagg ggtatttgat caagtttgag attgatgggg aacaacggac acggacgtgt       300
     tcggatcggc aaccggattg tggcctgatt gtggcctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page