(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE88

PENCW_13.PE88        Location/Qualifiers
FT   CDS_pept        199246..200643
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946590"
FT                   /orf_name="Pc16g00880"
FT                   /product="Pc16g00880 protein"
FT                   /protein_id="CAP92758.1"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="UniParc:UPI000183131C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z4"
FT                   /transl_table=1
FT                   /translation="MSSSPRRWLFVGFPILTFCFIYYLFRLPESNPSILNNSEELSQAG
FT                   GEPILVGGQKQERPPPPPPKEETLEEKCGHLLHALDDVMVVIRTGATESLEKIPVHLRT
FT                   TLQCVPHFAIFSDYEETINGVRTYDVLRNISETTMNHEPEFDIYRRLQEVGREGLTEAE
FT                   WGDDTNGPLGKVNNPSWKLDKWKFLPMIDEALEVMPDAKWYVFLEADTYMVWPNLINWL
FT                   AHLNPDRQYYLGSPMQIGETLFGYGGAGIVLSSWTMNLLHEYQIEAKEDLEAMTAHEWA
FT                   GDCALARALQGVKVDLTWAWPMMMTSRPWEIDHFSEGYGRQPWCYPVISYHHMAPKDIE
FT                   EMWEFDRAFFASGKNALMLHADVYQKLIYDGTFSARDDWDNLSGIQIDFAAGTIPTVEV
FT                   CAEVCARNDECLQYSFNHADGVCKHASTTFAGVATNGTQSGWITSRVNKLLRAFQSSCH
FT                   EVQYIFD"
     atgtctagtt ctccgcgacg atggctcttc gtgggctttc cgatccttac attttgcttc        60
     atatactatc tctttcgact gcctgaatcc aacccgtcaa tcctgaacaa ctcagaagaa       120
     ctttctcaag ctggagggga accaattttg gtagggggac agaagcagga aagacctccg       180
     cctccccctc ccaaagagga gacattggag gaaaaatgcg gccacctact acacgcactt       240
     gacgatgtca tggtcgtaat cagaactggc gcgactgaat ccctcgaaaa aatccccgtc       300
     cacctccgca ccaccctgca atgcgtcccg cactttgcca tcttctccga ctatgaagaa       360
     acaatcaacg gcgtccgcac gtatgacgtc ctccgcaaca tcagcgagac aacgatgaac       420
     cacgagcccg aattcgacat ctaccgccgt ctacaagaag ttggacgcga aggcctaaca       480
     gaagcagagt ggggcgacga cacaaacgga ccactaggga aagtcaacaa cccgagttgg       540
     aagctcgaca aatggaaatt cctcccaatg atcgacgaag cacttgaagt catgcccgac       600
     gccaagtggt acgtcttcct cgaagccgac acctacatgg tatggccgaa cctgatcaac       660
     tggttggcgc acctcaaccc agatcggcaa tactacttgg gcagccccat gcagatcggt       720
     gaaacactct ttggctacgg cggggcgggc atcgtccttt caagctggac gatgaacctt       780
     ctgcacgagt accagataga ggcaaaggaa gacctcgaag cgatgaccgc acacgaatgg       840
     gcaggcgact gcgcgctggc gcgagcgctg cagggcgtga aagtggatct gacctgggcc       900
     tggccgatga tgatgacatc acggccgtgg gaaatcgacc atttctccga gggatacggg       960
     cgacagccgt ggtgttaccc tgttatctcg taccaccaca tggcgccgaa ggatattgaa      1020
     gagatgtggg agtttgaccg agcattcttt gctagtggga agaacgcgct catgctgcat      1080
     gcggacgttt accagaaact catctacgac gggactttct cggcgcgcga cgactgggat      1140
     aatctctctg ggatccagat tgattttgcc gctggcacga tccctacggt tgaggtttgt      1200
     gcggaggtct gcgcacgcaa tgatgagtgc ttgcagtatt cgttcaacca cgccgacggt      1260
     gtttgtaaac atgcttctac taccttcgcg ggtgttgcta ccaatggcac gcagtctggt      1320
     tggattacat ctcgggtgaa caagcttctc agggcattcc agtcttcatg ccatgaggtt      1380
     caatatatct ttgattga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page