(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE90

PENCW_13.PE90        Location/Qualifiers
FT   CDS_pept        join(complement(205057..205250),complement(204745..204988))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946591"
FT                   /orf_name="Pc16g00900"
FT                   /product="Pc16g00900 protein"
FT                   /protein_id="CAP92760.1"
FT                   /db_xref="UniParc:UPI000183131D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z5"
FT                   /transl_table=1
FT                   /translation="MKFTVFSLLLSASAALATPFVERDSSIQISDFWARASAGSSATMH
FT                   FVVTDPNYPDDTPTDCNLIWSYGSSPKESARCNNSQYYIRFPEGAVDFNRFTLELERVS
FT                   GPIAENGQVLLRSGTQWSCVDNPESGVHLSCSYDGVLSMPV"
     atgaagttca ctgtcttctc ccttcttctg tctgccagtg cagccctcgc caccccgttc        60
     gtcgaacgag acagctctat tcagatcagt gatttctggg ccagagctag cgctggctcc       120
     tccgctacga tgcatttcgt cgtgactgat ccaaactacc ccgacgacac ccctactgac       180
     tgcaatctaa tatggtcata cggatcctcg cccaaggaaa gtgcccggtg caacaacagt       240
     caatactata tccgcttccc cgaaggtgcc gtggacttta accggtttac acttgaactt       300
     gagagagtct cgggtccgat tgctgagaac ggtcaggtct tgctgaggtc aggtacgcag       360
     tggtcttgtg tggacaatcc ggaaagtggc gttcatctga gctgctctta tgacggtgtt       420
     cttagcatgc ccgtgtga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page