(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE92

PENCW_13.PE92        Location/Qualifiers
FT   CDS_pept        join(209148..209365,209439..210052,210119..210368,
FT                   210433..210555,210622..211183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946592"
FT                   /orf_name="Pc16g00920"
FT                   /product="Pc16g00920 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92762.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183131F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y5"
FT                   /transl_table=1
FT                   /translation="MEKTNVSDQVTPATTSRDAEKMGEFDVHQGVDKPSDEASMSDRDS
FT                   RDFQGGVQRVRAITSAWSTKTLVLMFILLYLVSFVDALLSTVETSLNPYITSSFGKHGL
FT                   LTVVSVLSTILGGSSKLTLAKIIDVWGRVEGFLIMLVLVAIGLIMKATCKNIEMYTAAH
FT                   TLYWVGHIGLTYVVDIMLADMTSLRNRMIMLGLNGTPGIASTFAGPKIAALFYANLDFH
FT                   WAFGAFAIMQVGVCIPVAVVMLFMQRRAEKSGALEKTYSGRNWWQSIAHYVIEFDVVGI
FT                   ILVTAVFTLILLPFSIAPYGPKGWATGYIIAMEVLGVACIPAFYVWERYAPVQFLPWKY
FT                   LKQPTMIGSCMLYGVMFISVFTWNSYFSSYLQVVNRLDITSANYVLNAFSLTSYIFSPI
FT                   FGLVIRWTGDFRWTAMAGIPIFLLGTALLIPFRAPDTHVGLLTMVQILVGLGSCMFTVC
FT                   GQIAVMAIVTHQEIAVVLAIWGLFGSIGAGVGSAIAGGMWNNMFLKELTERLPLESKHL
FT                   AATIYSNIVTQMKYADGTPEREAIVGAYADIQRKMVIVGVCFVPLCIVCTWFWRNVNVK
FT                   KLQKEQTSGNVW"
     atggaaaaga caaacgtgtc cgatcaggtc acgccggcca ctaccagccg cgatgctgag        60
     aaaatggggg aattcgacgt tcaccagggc gtggacaaac catctgatga ggcgagcatg       120
     tccgatcggg actcgcgtga cttccaaggt ggtgtgcagc gagtgcgagc cattacatcg       180
     gcatggtcaa ccaagacgct cgttctgatg ttcattctgc tctatctcgt gtccttcgtt       240
     gacgcactcc tgagcacagt cgaaacctca ctaaacccct acattacctc ctcattcggc       300
     aagcacggcc tcttgacggt cgtcagcgtc ctctcaacca tcctgggcgg ctcatcgaag       360
     ctcacactag ccaagatcat cgatgtctgg ggtcgtgtag agggattcct gattatgctt       420
     gttcttgtcg cgatcggtct gatcatgaaa gccacttgca aaaatataga gatgtacact       480
     gcagcacaca ctttatactg ggtgggccac atcggtctga cctatgtcgt ggacatcatg       540
     ctggcagata tgacctccct caggaaccga atgatcatgc tgggtctgaa tggtacaccc       600
     ggtatcgcta gtaccttcgc aggcccgaaa attgccgcac tcttctacgc caacctcgac       660
     ttccattggg cattcggtgc gtttgctatt atgcaggtcg gagtttgtat ccccgtcgct       720
     gtggtgatgc tgtttatgca acgtcgggcg gagaagagcg gtgctcttga gaagacttac       780
     tctggacgta actggtggca gtcgatcgct cactatgtca tcgagttcga tgtcgtcgga       840
     atcatcctgg tcactgccgt attcacccta atcctcctcc cgttcagcat cgccccctac       900
     ggacccaagg gatgggcgac cggatacatc atcgcgatgg aagtcctcgg cgtagcatgc       960
     attcccgcat tctatgtctg ggagcgatac gcaccggtgc aattccttcc gtggaagtat      1020
     ctgaaacagc caacaatgat cggctcatgc atgctgtacg gcgtgatgtt catctccgtc      1080
     tttacctgga acagctactt cagctcgtac ctgcaagtcg taaacagact cgacatcacc      1140
     tcagccaact acgtgcttaa cgctttctcc ctgacctctt acatcttcag ccctatcttt      1200
     ggcctagtaa tccgatggac cggtgacttc agatggaccg ccatggctgg catcccaatc      1260
     ttccttctcg gaacagctct tctgatcccg ttccgtgcgc cagacaccca cgtaggcctg      1320
     ctaacaatgg tccaaattct cgtgggtctc ggcagctgca tgttcactgt gtgtggacag      1380
     atcgctgtga tggcgatcgt aacgcaccag gagatcgccg ttgtgctcgc gatctgggga      1440
     ttgttcgggt cgattggagc cggcgtggga tctgctattg ctggtggcat gtggaataat      1500
     atgttcctaa aggagctaac tgaacggctg ccgctggaga gtaagcatct tgcggccact      1560
     atctattcca atattgtgac gcagatgaag tacgccgatg gtaccccgga gcgggaagct      1620
     atcgttgggg cttatgctga tatccagagg aagatggtga ttgttggtgt ttgtttcgta      1680
     ccgctgtgca ttgtgtgcac ttggttctgg aggaacgtta atgttaagaa gttgcagaag      1740
     gagcagacga gtggaaacgt ttggtag                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page