(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE94

PENCW_13.PE94        Location/Qualifiers
FT   CDS_pept        complement(215273..216325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946593"
FT                   /orf_name="Pc16g00940"
FT                   /product="Pc16g00940 protein"
FT                   /protein_id="CAP92764.1"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI00018313ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y7"
FT                   /transl_table=1
FT                   /translation="MWNKTKTYGKKGFDKGWDALDKLGAPVNRLSNKLGSEAFWPMTLD
FT                   KESEKVARILRSFCKDGVYVEDSPPVALPPGNRKENQIDRPRGKQKVLKKIPKEVIRDA
FT                   KGLVIFTAMRTGLWVSGASGSGVLIARMPETGEWSAPSGILMHTAGVGFLVGADIYDCV
FT                   MVINTYEALEAFYNVRVTLGSEVTVAAGPIGIGGVLESEVHKRRAPIWTYVKSRGFYAG
FT                   MQVDGSIIIERNDENERFYGRKVPVKDIMSGQVRTNAPGARMLTHTVHSAQGDSHFDRV
FT                   PTGVQAPTGPTPSDFAPGDLPEYSAQPPMMSGVNAAPHGPYAAPNNAPYADTHWAPNGM
FT                   NYGPGSGKQD"
     atgtggaaca aaacaaaaac ctacggcaaa aaaggcttcg acaaaggctg ggatgccctc        60
     gataaactcg gtgcccccgt caaccgcctc agcaacaaac tcggctccga ggccttctgg       120
     cctatgaccc tcgacaagga aagcgagaaa gtcgcccgca tcctccggag cttctgcaaa       180
     gacggtgtct atgtcgagga ttcgccgcca gttgcgcttc cgcctgggaa cagaaaagag       240
     aaccagattg atagacctcg cgggaagcag aaggtgttga agaagatccc aaaggaggtc       300
     atccgcgacg cgaaggggtt ggttatcttt acggcgatgc gaacggggct gtgggttagt       360
     ggtgcttctg gtagcggagt gcttattgca cgcatgcctg agacggggga gtggagtgcc       420
     ccgtctggga tcttgatgca tactgcgggc gttgggttcc ttgttggtgc ggatatctac       480
     gactgtgtta tggtgatcaa cacctacgaa gcactggagg ccttctacaa cgtgcgtgtg       540
     accctaggca gcgaagtcac cgtcgccgct ggaccgattg gaatcggagg tgtgctggag       600
     tcagaggtgc ataagcgtcg ggctccgatt tggacctacg tcaagagccg gggattctat       660
     gccggtatgc aagtcgacgg aagcatcatt atcgagcgta acgacgagaa tgagcgattc       720
     tatggccgaa aggtgcctgt caaggatatc atgtcggggc aagttcggac aaacgctccg       780
     ggcgcgagaa tgttgacgca cacggtgcac tcggcacagg gagactcaca tttcgatcga       840
     gtgcccactg gagtgcaggc gccgacgggg ccgactccta gtgactttgc ccctggcgat       900
     cttcctgagt actccgccca accgcctatg atgtctgggg tcaacgcggc cccgcatggg       960
     ccgtatgcag ccccaaataa tgcgccttat gcggataccc actgggcacc caatgggatg      1020
     aattatggtc ctgggtcggg aaaacaggat tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page