(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE95

PENCW_13.PE95        Location/Qualifiers
FT   CDS_pept        216712..217245
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946594"
FT                   /orf_name="Pc16g00950"
FT                   /product="Pc16g00950 protein"
FT                   /protein_id="CAP92765.1"
FT                   /db_xref="UniParc:UPI00018313EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y8"
FT                   /transl_table=1
FT                   /translation="MRNKRQVFLSLHHRNSLSLGGNRQRFGYAAYHWGILISSKGPSRP
FT                   DCYAFDVSNGVVLDPVHRVNLNEEGNWHFREKVNDPDQDSLLGRVMIGKVPHEVTYAQI
FT                   RDLLESIPLPQRDALPEQNCVTWTRAAIRKLQENGLAEQFDLNRFMDESLAFADQRLHT
FT                   RSTPTSINYTTRPM"
     atgagaaata agcgtcaggt ctttctttcg ctgcatcatc gcaattctct ctctctcgga        60
     ggaaacagac agcgatttgg ctacgcggcc taccactggg ggattctcat ttcttctaaa       120
     ggtcccagta ggccggactg ctatgctttt gacgtcagca atggagttgt cctcgatccg       180
     gtgcatcgag tcaatcttaa cgaagagggc aattggcact ttcgagagaa agtaaacgat       240
     ccagaccagg acagcctact tggaagggtc atgattggaa aggtgcctca tgaggttacc       300
     tatgcgcaaa tccgcgacct tcttgaatcg attccacttc cgcaaaggga tgctctaccg       360
     gaacaaaact gcgtcacttg gacgagagct gcgattcgta agcttcagga gaacggtctt       420
     gcagagcaat tcgatctcaa tcggtttatg gacgagtcgc tcgcattcgc agatcaacgc       480
     ttgcatacca gatctacacc cactagcatc aattacacta cccggcctat gtga             534
//

If you have problems or comments...

PBIL Back to PBIL home page