(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE96

PENCW_13.PE96        Location/Qualifiers
FT   CDS_pept        join(218357..220588,220652..220924)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946595"
FT                   /orf_name="Pc16g00960"
FT                   /product="Pc16g00960 protein"
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /function="ATP binding"
FT                   /function="shikimate 5-dehydrogenase activity"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92766.1"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="GO:0004764"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y9"
FT                   /transl_table=1
FT                   /translation="MLDPKPTIPPTADAKSDIPACATKESSSPMLRPEAAPRTFAPDAS
FT                   LVLIGIRGCGKRSLGFVAATALKRRFITEDHYFREVTGITRQEYLKQYGSQEFQRRDIE
FT                   VLKMMLDNHRTGCVVECGLASLTRPVQDHLRRYARSNPVVHLLRDIDRIQQLLGLEDQA
FT                   VRLFREGDPMHRICSNFEFYNLEDRTRTSDDGSPDRRSADYSFKLQEVKEDFTRFVQFI
FT                   TGLDVNYSSYDSPFVLLETPPELRSFTHAIFVRSSDLIVDNVNLTELESGGDAIELCVD
FT                   RWSPDMAATISKQVSVLRRNARTPVILSVDVSCIGTGSPEPATSSSRLYFDILEHGLRL
FT                   GVEYLVVDLTQDRSGLAATIRSRGNTKIIGQQVFEPSSPTTWDSAGCVAVYDEAEKLGC
FT                   QLVRLLRVATKREENAAVIEFSNKIRSLPGDHPPLIAYNIGSLGRTSQVFNSILTAVTH
FT                   PAITQSAENKHDPQITSRDAVRALFQSYVLDPLKFYIYGENVAYSLSPAMHNAAHQHCG
FT                   MGHTYSIPDSPSLAVLDRLGRDPHFGGSSVVQPWRVQVYQKLASKSRHAEAIGAINTIM
FT                   PLRGHEDGTMFPLQEQASRRNQAGRVLGWYGENTDWVGIMTCIRRHLSPRNAISAKTTG
FT                   LVIGAGGMARAAIYAMLRLGCRKIFIYNRTQSRAEEVARHFNSWASSQVDSTEVVRVLQ
FT                   SLQEDWPAGVAQPSLIASCVPADPDRDEPPANFEMPVQWLGSPTGGVILELAYKPLDTP
FT                   LLRQMRRVRSETGRPWVLSDGLENVTEQGIAQFELMTGRKAPRRLMTYEVLRNYVGDNG
FT                   RFDEKTIQARLDGVGSPMTGKE"
     atgctcgatc ctaaacccac tattcctccc acggccgacg ccaagtccga catccccgca        60
     tgtgccacca aggaatcttc ctctcccatg ctccgccccg aggctgcccc tcgcacattt       120
     gctcccgatg catccctcgt tctgatcggc atccgcggat gcggcaagcg ctccctaggc       180
     tttgtcgccg cgaccgcgtt gaagcgacgc ttcattaccg aagaccacta cttccgggag       240
     gtcacgggca tcacgcgaca ggaatacctc aagcagtatg gcagccagga gttccagcgc       300
     cgcgacattg aagtcttgaa gatgatgctg gataaccacc gcacaggatg tgtcgtggag       360
     tgtgggctgg ccagtctgac gcggcctgtg caggatcacc tgcgtcgcta tgcccggtcc       420
     aacccagtgg ttcatttgct gcgcgatatc gatcgcattc agcaattgct cggcttagag       480
     gaccaggcgg tgcggttgtt ccgggagggg gacccgatgc atcggatctg ttctaatttc       540
     gaattctata atcttgaaga tcggacgcgt acgtcggacg atgggagccc agatcgccgg       600
     tctgcggatt attccttcaa gttgcaagag gtcaaagagg attttacacg gtttgtgcag       660
     tttattactg gactcgatgt gaattattcg agctatgact cgccgttcgt tctcttagag       720
     acgccgccgg aactgcgctc ttttacccat gctatcttcg tgcggtcttc agatctgatc       780
     gtcgacaatg tcaacctgac tgagcttgag tctggtggag atgccatcga gctgtgcgtt       840
     gatcgctgga gcccagacat ggcagccacc atcagcaaac aggtctctgt cctgcgtcga       900
     aatgcgcgga cgcctgtgat tctctccgtt gacgtctcct gtatcggcac cggctccccg       960
     gaaccggcca cctcttcttc tcggctttac tttgatattc tcgagcacgg tttgcgcctg      1020
     ggtgtggaat atcttgttgt ggatctgact caagaccgat ccgggctggc tgcgaccatc      1080
     agaagtcgtg ggaataccaa aatcattggg cagcaggtct ttgagccatc ttcccccact      1140
     acatgggaca gtgcgggttg cgtagccgtc tacgatgaag ctgaaaagct tggttgtcag      1200
     ctcgtgcgcc tcctccgagt cgcaacaaag cgcgaggaga atgccgctgt gatcgagttc      1260
     tccaataaaa tccgatccct cccgggagat cacccaccgc tcatcgccta caacatcggt      1320
     tccctgggcc gtacctcaca agtgttcaac tcgatcctca ctgcagtaac acatccagcg      1380
     atcacccaat ccgcagagaa taaacacgac ccacaaataa cctctcgcga tgccgtccgc      1440
     gcgctcttcc aaagttacgt gctcgaccca ctcaagttct acatctacgg agagaacgtc      1500
     gcctacagtc tatccccagc aatgcacaat gccgcacacc aacactgcgg catgggccac      1560
     acctacagca tcccagattc gccctctctt gcagtcttag accgacttgg ccgggatcca      1620
     cactttggag gatccagtgt cgtgcagcca tggcgtgtac aggtatatca aaagctcgcc      1680
     tcgaaaagcc gacatgctga agccatcggg gcaatcaaca caattatgcc gctccgcggg      1740
     cacgaagacg gaacgatgtt cccacttcag gaacaagcca gccgacgcaa ccaggctggg      1800
     cgtgtgctgg ggtggtacgg cgagaatact gactgggtcg ggataatgac gtgcatcagg      1860
     cgacatctct cgccgcgcaa cgcaatcagc gcaaaaacga caggcctcgt tattggcgcc      1920
     ggcggcatgg cgcgggccgc catctacgcc atgcttcgac ttggatgtcg gaagatcttc      1980
     atctacaacc gcacgcagtc gcgtgccgag gaagtcgcgc gccacttcaa ctcctgggcg      2040
     tcgtcgcagg tggactcgac tgaagtggtt cgtgtcttgc agtcacttca ggaagactgg      2100
     cctgcgggcg ttgctcagcc tagtctcatt gcctcttgtg tgccggctga tccagaccga      2160
     gatgaaccac cggcgaactt tgagatgccg gtgcagtggc ttgggagtcc tacagggggt      2220
     gtgatactcg agttggccta taaacccctc gatacaccac tgctacggca aatgcgccga      2280
     gtccggagcg agactggacg gccttgggtc ttgtctgacg gattggagaa tgttactgaa      2340
     cagggtattg ctcagtttga gttgatgaca ggccgcaaag cacctcggcg gcttatgacc      2400
     tatgaggtct tacgcaatta tgtaggtgac aatgggcgtt ttgacgagaa gactattcag      2460
     gctcgtctag atggtgttgg gtctccgatg actggaaagg aatag                      2505
//

If you have problems or comments...

PBIL Back to PBIL home page