(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE97

PENCW_13.PE97        Location/Qualifiers
FT   CDS_pept        join(221215..221309,221366..222101)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946596"
FT                   /orf_name="Pc16g00970"
FT                   /product="Pc16g00970 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92767.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="UniParc:UPI00018313F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z0"
FT                   /transl_table=1
FT                   /translation="MPGFSPEQPDSITATWKKRKWDHEESRTLARPPTYVPSYRVDRPE
FT                   YDGSCSLPLSRHPDGTDISFRPRCLPRKRRHVQGPYLTLPSHQHQHQHQLQQPHGLQHQ
FT                   QSPTHLSPNIYGTPNQDPYSPPVSPKTLVPLHYPTQQSASPSALRPCHICHRRPTTRQV
FT                   LDAYADCDLCHERACFICLRQCDSASCGGAFGLSKDSSIHMHMHSGSTDDASYDASEAA
FT                   RRKICSGCAVEEVTDTGAEIVRCLDCVRGAGSWAAATIPSDWALDDMQHEDMTG"
     atgccagggt tttcgcccga gcagcccgac tcgataacgg caacatggaa gaaacgcaag        60
     tgggaccatg aggagtctag gactctagca cgtccaccaa catatgtccc atcctaccga       120
     gtcgatcggc ccgagtacga tggtagctgc tcattgcctc tatcacgaca cccagacgga       180
     acagacattt ccttccgacc acgctgcctc cctcgcaagc gccgacatgt tcaaggccct       240
     taccttacac tgccatccca tcagcaccag catcaacatc aactgcagca gccacatggt       300
     ctccaacacc aacaatcccc aacccacctc tccccaaaca tctacggcac cccaaaccaa       360
     gacccatact cacccccggt ctccccgaaa accctcgtcc ccttgcacta cccaacccag       420
     caatccgcct ccccttctgc cctccggcct tgtcacatat gccaccgccg cccaacaacc       480
     cgccaagtcc tcgacgccta cgcagattgt gatctctgcc acgagcgagc atgcttcatc       540
     tgtctccgac aatgcgatag cgcatcctgc ggcggagctt tcggtctgtc gaaagattca       600
     agcatacata tgcacatgca ctcgggctca accgacgacg ccagctacga tgccagcgag       660
     gcggccagga ggaaaatttg ctccggctgt gctgtggaag aagtcaccga caccggggcg       720
     gagattgtcc gctgccttga ctgcgtgcgt ggtgcaggct cgtgggctgc ggcgactata       780
     ccgtctgatt gggctttgga cgatatgcag catgaggata tgactgggtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page