(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE98

PENCW_13.PE98        Location/Qualifiers
FT   CDS_pept        join(complement(223311..223815),complement(222684..223252))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824069"
FT                   /orf_name="Pc16g00980"
FT                   /product="Pc16g00980 protein"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /protein_id="CAP92768.1"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniParc:UPI00018313F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z1"
FT                   /transl_table=1
FT                   /translation="MVSQRDREILRDDLRARGTKLSAAERESLLKGYLPDPAELGTKPA
FT                   PQPTASERRKAQRKTPIRTFLKSQTHYLAYAFTHIIFGIVVRLLQAYHAVVDRIFAIVY
FT                   HHHRTPELIRKDVKNLKRLPQHLSTILTLRKEDDALAVLMDEVAELAAWSSCSGISQLS
FT                   VYEKSGVLKSCIPTLHQIITTKLASYYGTPSHQPILQVFAPHHPVHRSAPISNTTDNTA
FT                   QHQTLTILLLSSTDGRETLVDLTKTLAEMSQNGKLSPEDITPDLVDAEISEITTQPLSM
FT                   DPSLPDTVLKPEPDLLLVFGPFLKLDGYPPWQLRLTEMYCTGGRSHGLSGDGEAVEYQG
FT                   YMRGLWHFAGAQMRFGR"
     atggtctccc aacgagatcg cgagatcttg cgcgacgact tacgcgctcg aggcacaaaa        60
     ctcagtgcag cggaacgcga atccctcctc aagggctacc tccccgaccc cgccgagcta       120
     ggtacgaagc cagcaccaca accgactgcc agcgagcgcc gcaaggcaca acgcaaaacg       180
     cccattcgca cattcctcaa gtcgcaaacc cactacctcg cctatgcctt tacgcatatc       240
     atcttcggca tcgtcgtccg tctcctgcaa gcgtaccatg ccgtcgtcga ccgcattttc       300
     gcaatcgtct atcaccacca ccgcaccccc gagctgatcc ggaaagatgt gaagaatctc       360
     aagcgcttgc cgcagcatct gagtacaatc ctcacactta ggaaggaaga tgacgctctt       420
     gcggtattga tggatgaggt tgctgaattg gcagcctgga gttcgtgctc ggggatttcc       480
     cagctcagtg tatacgagaa gtccggcgtc ctgaaatcct gcatcccaac tctgcaccaa       540
     ataatcacca ccaaactcgc ctcctactat ggcaccccca gccatcaacc aatcctccaa       600
     gtcttcgccc ctcaccaccc agtccaccgc agcgcaccca tctcaaatac caccgacaac       660
     acagcccagc atcaaaccct gacaatcctt cttctctctt caacggacgg ccgtgagacc       720
     ctcgtcgacc taaccaagac cctggcggag atgagccaga acggcaagct ttccccggaa       780
     gatatcacgc cggatttggt cgatgcggag atcagcgaga tcaccacaca gccgttgtct       840
     atggatccca gcctaccgga tacggtgctc aaaccagagc cggacctgtt gcttgttttt       900
     ggcccattcc ttaagctcga tgggtatccg ccgtggcagc tgaggttgac agagatgtat       960
     tgtactggtg gacgcagtca tggacttagt ggggatgggg aggcggttga gtaccaaggg      1020
     tatatgcgtg gtctttggca ctttgctggg gcgcagatga ggtttggtag gtag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page