(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE99

PENCW_13.PE99        Location/Qualifiers
FT   CDS_pept        224209..226896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977300"
FT                   /orf_name="Pc16g00990"
FT                   /product="Pc16g00990 protein"
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92769.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI00018313F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z2"
FT                   /transl_table=1
FT                   /translation="MDNASINTSSARTVFPQGPSFTLEDFSSRDFIVKEFIESLSDAAI
FT                   SSRRSLAGLAGAANQPFDPKPLIRTFESAQRRLSELSGDLELRENELSAAVRRAEAQHG
FT                   QNLNTLGQKLRHTIENFQQLDTSLNAPGRENPAGTGNMAVETGKRLEELDRQRRRALDA
FT                   HFLIQCWDGVCNRGEISLLESLRRSGTGEAKVRSAHIARQLLRISQRLDPQSWQEHRVR
FT                   PNGGYGNSSSSEDLSESSTPRRNTREIIEKFSETLEKDLLKQFDDFYRKANFDGMRDCA
FT                   TVLQDFNGGASVIALFVNQHQFFIERSQLVTEEVGGDPESWEKLADPDAELPGVESSLQ
FT                   SLIDEVKVVVQDESAIIRRAFPYYEQVLGKFLQRVFQQSIQQRLEMVLEKAAGVSSLAF
FT                   LRCLQSSRGYIGALIEDLKSHGLTEHPEPVSSQTAILLDQQLEELFVPYFVGSSYIERE
FT                   KRTLEELFNAVLFKFTSYHARRKKAATTFMASLSRAGSELLSTTRDAFISRLDSPEVSP
FT                   IQRKVLLGVAKVGDTLETTRLTEIKLTEEDGQPNLGDAKRMLKWLAEAVGRGLELSVNS
FT                   DTPKDVSALLNLLLLAMGEGYVDVCLDAALEAATSQESSKAEPDFSYLFSARTTISITT
FT                   LMVMCIHAVLLPLSAASITTRRDMEKRTSQTTSRIEDKINTIEQKTIDATFAWVSRLLS
FT                   GQKKNDFRPRESDNTAWLEMLHTPVRSIQHSTLKKALLIPRQTCASITSFLTRLHNIAR
FT                   TSLPSSGANVRQVLTEIALGIRGLLLEHFKRFSVSGPGGLMVTKDMTQYADLFRSWDID
FT                   EETKGPGGALDVLLEVGSLFVIGPEALRERIRGGAASGTTGGSGGPGRNPTQEGKLSVQ
FT                   EVRAYVSRREDSNTFAMQQVLNAL"
     atggacaatg catccataaa tacaagctcc gcccgcaccg tcttccctca aggccccagt        60
     ttcaccctcg aggacttctc cagtcgggac ttcattgtca aggagttcat tgaatccctc       120
     tccgatgctg cgatatccag ccgtcgctcg ctggccggtc tcgcgggcgc tgccaaccaa       180
     cccttcgatc ccaaacccct catccgcacc tttgaaagcg ctcaacgtcg cctgagcgag       240
     ctttccggag acctcgagct ccgcgagaat gaactttcag cagctgtccg acgggcagaa       300
     gcgcaacacg gccagaacct caacactctc ggccagaagc tccgccacac catcgaaaac       360
     tttcaacagc ttgacacgtc gctaaatgcc cccggccgcg agaatccagc agggacgggg       420
     aatatggcag tggagacagg gaagcgctta gaggagctag accgacaacg gcgacgagct       480
     ctggatgccc attttctcat ccaatgctgg gacggtgtgt gcaaccgggg cgagatctcg       540
     ctattagaga gcctgcggcg atctggcacg ggagaggcca aggtgcgctc cgcacatatt       600
     gcgcgccagc tgctgcgtat tagtcaacga ctagatccgc agagctggca agaacataga       660
     gttcgcccca atggtggata cggaaatagc tcctcgtctg aggatctcag cgagagcagc       720
     acgccgcggc ggaacacgcg agagattatt gagaagttct ccgagacatt agagaaggat       780
     ttgctgaagc agtttgacga tttctaccgc aaggctaact tcgatggtat gagagattgc       840
     gcgacggtgt tgcaagactt caatggcggt gccagtgtta ttgccttgtt cgtcaaccag       900
     catcagttct ttatcgagcg cagccagctg gtaacggagg aagtcggagg cgatccggaa       960
     tcgtgggaaa aactggctga tccggacgcg gagcttcctg gtgttgaatc cagtctccag      1020
     tcgttgatcg atgaagtcaa ggttgtggtt caggacgagt ctgccattat tcggcgggcc      1080
     ttcccctact acgagcaagt cctgggcaag ttcttacagc gggtcttcca gcagtctatc      1140
     cagcagcgcc tggaaatggt actggagaaa gcagccggtg tatcatcact agcgttcctc      1200
     cgttgtcttc aaagctcacg tggctatatc ggtgccttga tcgaggatct gaagtcgcac      1260
     gggttgaccg agcatccgga acctgtttct tcgcagacgg ctatattgct agatcagcag      1320
     ctggaggagc tttttgttcc ttatttcgtt ggatcgtctt acatcgaacg cgagaagcgg      1380
     acgttagaag aacttttcaa tgcggtcttg ttcaaattca cctcttacca tgcccgccgc      1440
     aagaaggcgg caacaacctt catggcctcg ttatcccggg ctgggtcaga actcctgtcg      1500
     actacacgcg atgcatttat cagccggtta gactcaccag aggtctcacc tatccagcga      1560
     aaagtcctgc tcggcgtagc caaggtaggc gatacgctgg agacaactcg gttgaccgaa      1620
     atcaagctca cagaagaaga tggacaaccc aatctcggcg acgctaagcg gatgctcaag      1680
     tggctggctg aagctgtggg ccgaggactc gagctcagtg tcaacagcga cacccccaag      1740
     gatgtctccg ccttgctcaa cctgcttctc ctcgcgatgg gagagggata cgtggatgtc      1800
     tgtctagacg ccgctctgga agcggctacg tcacaagaat ccagcaaggc cgagcccgac      1860
     ttttcctacc tcttctcagc tcgcactacg attagtatta ccacattgat ggtgatgtgc      1920
     atccatgcgg tccttctccc tctatcagcc gcgagcatca ccactcgccg ggatatggaa      1980
     aagcgcacca gccaaaccac ctcgcgcatc gaggacaaaa tcaacactat cgagcagaaa      2040
     accattgacg ccacattcgc ctgggtcagc agattgctat ctggccagaa gaagaacgac      2100
     ttccggccta gagagagtga taacaccgca tggttagaga tgctacacac tcccgtacgt      2160
     tccatccaac attcaaccct taaaaaagcc ctactaattc cacgacagac ctgcgcatca      2220
     atcacctcat tcctaacacg tctccacaac atcgcacgca cctccctccc atccagcggc      2280
     gccaacgtgc gccaagtgct gaccgagata gcactcggaa tccgcggtct cctcctcgag      2340
     cacttcaagc ggttctccgt cagtggacct ggcgggctaa tggtaaccaa agacatgacg      2400
     caatatgcag acctcttcag atcctgggac attgacgagg aaaccaaagg ccccggtggc      2460
     gcgctggacg tgctactgga agttggtagt ctattcgtga ttggccccga ggctctccgc      2520
     gaaagaatcc gcggtggtgc tgccagtggc acgactggcg gatctggggg cccgggacgc      2580
     aatcctaccc aggagggtaa attgagtgtg caggaggtgc gggcttatgt ctcgcgtcgc      2640
     gaggactcca atacttttgc tatgcagcag gtccttaatg cattgtaa                   2688
//

If you have problems or comments...

PBIL Back to PBIL home page