(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_14

ID   PENCW_14; SV 1; linear; genomic DNA; GRV; FUN; 292067 BP.
XX
AC   AM920432_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 15)
XX
DE   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-
DE   1255) contig Pc00c17, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Penicillium; Penicillium chrysogenum complex.
XX
RN   [1]
RX   PUBMED; 18820685.
RA   van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M.,
RA   Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.
RA   H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.
RA   C., Nijland J.G., Pronk J.T., Roubos J.A., van der Klei I.J., van Peij N.
RA   N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.
RA   A.L.
RT   "Genome sequencing and analysis of the filamentous fungus Penicillium
RT   chrysogenum.";
RL   Nat. Biotechnol. 26:1161-1168(2008).
XX
CC   This Genome Reviews entry was created from entry AM920432.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..292067
FT                   /organism="Penicillium chrysogenum"
FT                   /strain="ATCC 28089 = DSM 1075 = Wisconsin 54-1255"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:500485"
FT                   /citation="[1]"
FT   CDS_pept        complement(492..>1316)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940109"
FT                   /orf_name="Pc17g00010"
FT                   /product="Pc17g00010 protein"
FT                   /protein_id="CAP79288.1"
FT                   /db_xref="UniParc:UPI00018311BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAT8"
FT                   /transl_table=1
FT                   /translation="MILVKWCLLLQAVAFSPTYAHLRMASPEPYGSSRKTLDNSPLAAD
FT                   GSDFPCKISPGDFIVPTEEATYRTGSNNSIKLLGSATHGGGSCQVSLTSDREPTKNSEW
FT                   KVIKSYEGGCPAKGPGNLDGSAESDHSLQLHFAIPDGIAPGKYTLAWTWFNRIGNREMY
FT                   MNCAPITVANESPSNSSDNTPKQSLAFPPMFIANVNGCITRENVDIHFPWPGSIVEYNG
FT                   DSKYRPQEGEPVCTGNPTFGPIPITDTADTGEANSTTENANSMPCSCGCQGS"
FT   mat_peptide     complement(495..1256)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAT8 "
FT   CDS_pept        join(1934..2143,2200..2259)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940110"
FT                   /orf_name="Pc23g00060"
FT                   /product="Pc17g00020 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP79289.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00018311BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAT9"
FT                   /transl_table=1
FT                   /translation="MDVQPKLKTKPADAANQKARRRRKSLFKKASEYSSECDADIHLVL
FT                   RMKKSGKIFVLVSNTKDWPLSQHQLKSYHPTPIQMSLSDPESKP"
FT   CDS_pept        complement(3156..4259)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822502"
FT                   /orf_name="Pc17g00030"
FT                   /product="Pc17g00030 protein"
FT                   /protein_id="CAP79290.1"
FT                   /db_xref="UniParc:UPI00018311BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU0"
FT                   /transl_table=1
FT                   /translation="MDTLMTSLPPNVGAILMGNISIIQIVSMFSIGAYNALETGIVTFD
FT                   SFKRYRGLYFWSMQFASWGILVHAIPAMARFISQASNLPTSIPFMIGWYAMVTGQAVVL
FT                   YSRLHLVFSDMRKVRWVLWMIITNACILHIPMTVFFFGLNRGDAHFARPAAIFDRIQST
FT                   VFCIQDFVICGIYIYKAVHHFKSAITIRGRDGHNAIIHLFCINILVVILNVLLLLAEYK
FT                   LHYIQVSFKTVVYSVKLKLEFSVLNRLRLLTSTNPCICQRGPEDSRRSNDKNIFGMASS
FT                   RPVIAPDVSSQSGAAQTNMPRSLRPSIYGYDEALRETSCENMMSPGDVYSSATLSEGHS
FT                   NTLPGGSSETLPALELSLSQFSPKFDV"
FT   CDS_pept        join(4790..4836,4922..4985,5038..5229,5273..5446,
FT                   5549..5659,5745..5867)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669749"
FT                   /orf_name="Pc17g00040"
FT                   /product="Putative uncharacterized protein Pc17g00040 "
FT                   /protein_id="CAP79291.1"
FT                   /db_xref="UniParc:UPI00018311BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU1"
FT                   /transl_table=1
FT                   /translation="MVEVVPTVIGECRRIRTGRMSRMLEKEWDLAISVSQSLIRSNPLN
FT                   VYKLSARVIRLAIESEHIESADFAFEVGILIREASTEEVTYLLEHPSKHETNENQQVGE
FT                   PNHGLLSAYHSFAGHLRDIPNTSTAVPVRVVPSAGPSNKGMLHHYWPVETRLVDRDRTS
FT                   VGPYSHAVFDWSYKCFLCPGSYQSVKVALQSCGVPVMAFSTRSRSLIVSYGTMVSFEEC
FT                   STSGNGWSNLDPKS"
FT   CDS_pept        join(6435..6587,6693..7262)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940111"
FT                   /orf_name="Pc17g00050"
FT                   /product="Putative uncharacterized protein Pc17g00050 "
FT                   /protein_id="CAP79292.1"
FT                   /db_xref="UniParc:UPI00018311C0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU2"
FT                   /transl_table=1
FT                   /translation="MAKDQKPSRRGADRGIATTKLGTGRSCASSPCSARSTVSRSKAVG
FT                   KLHKGLGHSIAKRARKKNDEATHQKCLAMMDEVQEECQLALEEIDKERAHDSQSMQRLH
FT                   AEKAQETSKLQEAITAKGKALAENQRLERELCQLQQAKEXSHATMQGLVSWHDIQPVLH
FT                   QTHGELVSATTRFWNTIDALQNRRLASYLPSSGGIHGNWPEQDGPLGTLGHNALPGFSA
FT                   SSDYPLVTQEAPVPINQY"
FT   CDS_pept        join(complement(11068..11237),complement(10935..10983),
FT                   complement(10808..10889),complement(10620..10721),
FT                   complement(10361..10482),complement(9960..10118))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940112"
FT                   /orf_name="Pc17g00060"
FT                   /product="Putative uncharacterized protein Pc17g00060 "
FT                   /protein_id="CAP79293.1"
FT                   /db_xref="UniParc:UPI0001831294"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU3"
FT                   /transl_table=1
FT                   /translation="MQIPATTHGTVDQGGSSCGPEKFEGFARVQTRSTSPKFSAISVRW
FT                   NGGLLPRYCWGSEEKLTLSSGRLNFVNLISPDNYTGYTLFEPDNSSPYAQFYRQSEEPI
FT                   GSREWVLWAGPPAAPKLYPKHPARLGNDAEYKLSMRITRDSRILPHPLTERAFPWLIER
FT                   YFPGFGDRSTIPHRYRRTAGSMDVPLIGISASWLHRHNVHSLKSATKIVFLHAVKGGVM
FT                   ASRGL"
FT   CDS_pept        join(11389..11435,11714..11896,12053..12196,12566..12650,
FT                   12706..12744)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126764"
FT                   /orf_name="Pc17g00070"
FT                   /product="Putative uncharacterized protein Pc17g00070 "
FT                   /protein_id="CAP79294.1"
FT                   /db_xref="UniParc:UPI0001831295"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU4"
FT                   /transl_table=1
FT                   /translation="MGAEITHFIVLEPRLCTSTLMKQTVTVASDHGQNGQSSQSATALS
FT                   DLIANSMICENHILAVSVFSAVEKVVHHTERSVSVDVSVDVSVDVSVDVSVDVCGGQYS
FT                   AGEGDGHRLDLAIGPCHPQIIRNLRLYWDKSSICDNVTKFAMLDEPEGQAAAVAGAVCA
FT                   FK"
FT   gap             13365..13464
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(15132..15544),complement(14320..15082))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940113"
FT                   /orf_name="Pc17g00080"
FT                   /product="Pc17g00080 protein"
FT                   /protein_id="CAP79295.1"
FT                   /db_xref="UniParc:UPI0001831296"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU5"
FT                   /transl_table=1
FT                   /translation="MAEVVGTASAITTFVALALQSSIVLYQTVQSLQSRDKEVRELRHE
FT                   LEALQGVLLALEESIDNLDVELASLEQPLMRCKSACEEFNTLIRGCTTHSTEDHSSRRD
FT                   WLKLRYMGEDISGFKNMLAGYKSTISIALAYANLRTTKTTRVVLEQYKELIENTKCDLE
FT                   SHLRDIRTRLQTACAQGPVISGVDTAELQMMEDEKNSTQKSLDICEQFLTLINQSRPSL
FT                   LGDVERSSGSFDYMSSSVAPNLSWLINAEGLNSAHKEVTSWKLRLLQHLHGVGQNMRGQ
FT                   RRYLPSLDNETTSEEQTFREELNGTEALLAFCKQAEEDANRPRTHYFEDVSTGDNSRQA
FT                   IVTTLEDLISAKRIKSGNNSYQALGRMADESIQSFFSRPEPSASSNDQDKQ"
FT   mat_peptide     join(complement(15132..15466),complement(14323..15082))
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU5 "
FT   sig_peptide     complement(15467..15544)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU5 "
FT   CDS_pept        complement(<16932..>17240)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        17969..23078
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(28087..28098),complement(27164..27979))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940114"
FT                   /orf_name="Pc17g00110"
FT                   /product="Pc17g00110 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP79298.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI0001831297"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU7"
FT                   /transl_table=1
FT                   /translation="MSALVWDVVSGDLQRPDCLFKYAKPITADIHPLVEPHLNGAVRQR
FT                   TIEARLEVEERHREWSRREAEAYHTIFRYLSPHISIHVAGLETSRDLWNELEERYRRME
FT                   LVTFCELFAQLRETTGERCGSAREFVDRVRLLVHRSNAIAPGSIGDRAHIAILLTQIGP
FT                   EYVLIVDAIQNDKDPVNPTTIGNRLSNAEQTVRRKESPTPLQAASGPSVNTVQQTAKKC
FT                   NYCKKRGHVVAQCWKKQREAQPSRDHALKAERSVSGSPRKSLRNIPSRSATKG"
FT   CDS_pept        join(complement(28804..28876),complement(28428..28756))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940115"
FT                   /orf_name="Pc17g00120"
FT                   /product="Pc17g00120 protein"
FT                   /protein_id="CAP79299.1"
FT                   /db_xref="UniParc:UPI0001831298"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU8"
FT                   /transl_table=1
FT                   /translation="MSEQSSSGPHRSKLANKLDPRVDSGLINFPGSHNVPDAHLGYAHN
FT                   YGKGGRHDNKIANMLDPRVYSDQDNSHRGNVAASTTFVPQAGKLAGIYNPEADEPYQRV
FT                   ESNSSNRRCENVAGSSHFIPQTGKPTSNP"
FT   CDS_pept        complement(<31903..>32029)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        <33147..>35297
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        <38756..>41048
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(42726..42825,43167..43705)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940116"
FT                   /orf_name="Pc17g00160"
FT                   /product="Putative uncharacterized protein Pc17g00160 "
FT                   /protein_id="CAP79303.1"
FT                   /db_xref="UniParc:UPI0001831299"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU9"
FT                   /transl_table=1
FT                   /translation="MGIQPREKTFLLPFWPAACATWGHGDAWASHRSDIYVQKEWVKNA
FT                   CACNSPYLGHNTQFWSRDSTCYKAGGLSPITLNQKWEHSSPQRNSDAGMGGMRKVSCPL
FT                   RRPNFRNRLQRALSLSSLESEDTGSVSSSATGNTTGEESPSQEENDSGDQEDSDAADES
FT                   EQEAARQKRTVFGHETDSEIRGQTQLSGNSNTVALECLTELIQFHADII"
FT   sig_peptide     42726..42800
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU9 "
FT   mat_peptide     join(42801..42825,43167..43702)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAU9 "
FT   CDS_pept        44206..44943
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076695" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822503"
FT                   /orf_name="Pc17g00170"
FT                   /product="Pc17g00170 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP79304.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183129A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV0"
FT                   /transl_table=1
FT                   /translation="MEFHQSHGGLVIYQASPHSVQKHEGGCDGHYHGQPGCSIDPGSIY
FT                   CGSRPLICSLGYLPTSVPSNHLLPGPPPEYFDYAPSFFGACLFSNQANINSPYPRPLEA
FT                   LRRDSQNTVARPCQAFGQPVNLLHSSQDPSNLSIGGAQTNITRRPFKCGVQGCKSHFKL
FT                   QKTLNRHLASHSGERPHVCWVPGCQRSFLRRDNLKAHYTTHGKRKGRNRYVATLDRTAS
FT                   VYNPEXCGQLTPEGWPLDYSGQN"
FT   CDS_pept        complement(<45373..>45782)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(48560..49699,49745..49783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940117"
FT                   /orf_name="Pc17g00190"
FT                   /product="Putative uncharacterized protein Pc17g00190 "
FT                   /protein_id="CAP79306.1"
FT                   /db_xref="UniParc:UPI000183129B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV1"
FT                   /transl_table=1
FT                   /translation="MVSLPRTDPLETAPPPRTAPLPRTSLPPRTAHCPPGVSLPKYCWI
FT                   CCRPIELSNYAPDTWKSVFQPLHISGDKGHLVPVRRHSLTEQPAVHACCWKVAELVLGR
FT                   SSFDPQLLNTIANHLFNLRLFAKPTPYNCETNGLDYALFAEPDALSETADEDICRDNFS
FT                   PEFFQQCFALLDQQPNVITIDQVERVDPCLACWISEWNQYDLQNDKNLNIRSCVQRIVK
FT                   NIKECDQSRFPETYNFRVAWSNVHEAVNAMNNSPLPIFVANDPQLPASPYGRKQCIPAK
FT                   TCRRLEFIFSSYVSSPCLSGIAYDGKLLGFKLRSSKSYHVRINDLKGLVLGRNSVGSIT
FT                   AIKVKNGENWSQWYGEPQSACSDIELEWENQNKMLIFHIDMLSRRISDVGAK"
FT   CDS_pept        complement(51148..52737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940118"
FT                   /orf_name="Pc17g00200"
FT                   /product="Pc17g00200 protein"
FT                   /protein_id="CAP79307.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183129C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV2"
FT                   /transl_table=1
FT                   /translation="MSLSSLPPELTLLISSHLNSPKDLSSFLRTSQKFYHLLTNELYQN
FT                   NVRSDGGSALLWYASRGDEVGVRNMLRTGANVNLRSPDRAQSTALLEAVSTKRTSVLQI
FT                   LLENGALPDMADARSRRPLVLATKGRSDVAITKLLLEHGAVANSVVLDKHAPLLEAVRS
FT                   NQESKVVLLLKHGADTHILDSRTGMTLVHIAASKNATPGIINILIGSGIQVESQDNMGR
FT                   TPLQVAADHSCTRAVRLLLNLGANPNFKNNNQYWKGWSALFYAATNPSIHRNGRKSIIR
FT                   TLFLHGAEIEARNHAQKTPLLHAISQSAIKQAQALVECGASIMARDANGETALHLAASS
FT                   SSWCSSLLGWLVETGADVNWVGGKHSETPIFNAIRRFYARQGMECIQTLLSLGADVQFR
FT                   NMDGLTPLSLAVRMGSIESTKILLEHGSCVNSRDENGKSPLHYAAEAWNVHKIVKLLIQ
FT                   YGADVNSRDMLGFTPLHRIVAKEETWEAAGELLKAGADRYAIAHNGKFPHEMVPDGPWA
FT                   ETKRSLIRFYMS"
FT   CDS_pept        join(54064..54346,54418..54465,54610..54935)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975705"
FT                   /orf_name="Pc17g00210"
FT                   /product="Putative uncharacterized protein Pc17g00210 "
FT                   /protein_id="CAP79308.1"
FT                   /db_xref="UniParc:UPI000183129D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV3"
FT                   /transl_table=1
FT                   /translation="MARPRRPSRNQQQSRIHVQVPNLLKGQVLTVKDFPPPGRSRETRS
FT                   HSIISMQRYRDDTATNEQGQPETSTVFSTTSQNVAGGTSTRSSWRSQPAIKRLVERYRG
FT                   KIDTIFTTSRIRFQFVHKWLLEESLMVGWTCPEELELHKLSKCLVEHRTRLGVALAAKP
FT                   LLLYKNGKDWFLASATLLSTVFHRIVNLFSTWPVSPLNSLSASVDFRAYRSFAVY"
FT   CDS_pept        join(complement(57319..57417),complement(57131..57226),
FT                   complement(56789..56977),complement(56646..56744))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940119"
FT                   /orf_name="Pc17g00220"
FT                   /product="Putative uncharacterized protein Pc17g00220 "
FT                   /protein_id="CAP79309.1"
FT                   /db_xref="UniParc:UPI000183129E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV4"
FT                   /transl_table=1
FT                   /translation="MADGNAVLYLRLARGPFGLTRINTAISRLAPLNDEDCLWEGMIAK
FT                   KGPDPLKNSQETGSSFQDNHVRFCDADLSDDPRDSRSGRFYLWPGEKLERIAEVQTRST
FT                   SPKFSAISVRWNGGLLPRRYCWGQATPRPWLCSLGRSNEQVSSPIKWQGAICQSGV"
FT   CDS_pept        complement(57696..58025)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940120"
FT                   /orf_name="Pc17g00230"
FT                   /product="Putative uncharacterized protein Pc17g00230 "
FT                   /protein_id="CAP79310.1"
FT                   /db_xref="UniParc:UPI000183129F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV5"
FT                   /transl_table=1
FT                   /translation="MQTYPARIVVDADLSCEAPFYTRGARGSEGAQVLHRWARGSDSRG
FT                   HGDSQARRQERGTMTHRSVRTEVLIVFGLGIRLLLYFFGYVSTKEPVAQMVARITVSLI
FT                   SVEAI"
FT   CDS_pept        join(58033..58250,58284..58623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940121"
FT                   /orf_name="Pc17g00240"
FT                   /product="Putative uncharacterized protein Pc17g00240 "
FT                   /protein_id="CAP79311.1"
FT                   /db_xref="UniParc:UPI00018312A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV6"
FT                   /transl_table=1
FT                   /translation="MPRRGVLRQQDYRRIGLRDQYASQGGAAKTRLPRRIGLRDQYASQ
FT                   GGAAKTRLPRRGALRYQVNSARGRCDDNSLQETAALPSSLQETAALTSSLQETAALPSS
FT                   PQLGPASKKRLAGTSATTRASSTCRHLFVVLGTSIRVFQEYSEKQRPAQHLHRLFIVPK
FT                   GHHWIHRRSPSQRSLPIQQPKS"
FT   CDS_pept        join(complement(60834..60983),complement(60570..60786),
FT                   complement(60066..60262))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940122"
FT                   /orf_name="Pc17g00250"
FT                   /product="Putative uncharacterized protein Pc17g00250 "
FT                   /protein_id="CAP79312.1"
FT                   /db_xref="UniParc:UPI00018312A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV7"
FT                   /transl_table=1
FT                   /translation="MGGPTLFSDGIRHFLKPDNPTGAGKCRCFVLLNGRGALPSPLAML
FT                   LVQIRANFGHTSNEPRRQDRYRGTAQSAKGLNNTIRYRPVSYSALLRCSTYTNERKRTR
FT                   WRYTELHQVGVRNVSFGTVCNYTTPFSQQQSMLDRMNPGTTPQKAIIGGLGAVVDIDTW
FT                   ETAGDINRSYQRGDYLQCCGDSRM"
FT   CDS_pept        join(63306..63419,63466..63864)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975706"
FT                   /orf_name="Pc17g00260"
FT                   /product="Putative uncharacterized protein Pc17g00260 "
FT                   /protein_id="CAP79313.1"
FT                   /db_xref="UniParc:UPI00018312A2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV8"
FT                   /transl_table=1
FT                   /translation="MESPNSSPDQGKVQQPSELAILSDINNNLEPSDHVPSLPSTSHHK
FT                   KERHTFATKPFQPILKVLVDLERDDHKFAFPAARLVGLYRCLWESCVTKHIDGEQLEQS
FT                   NQVLKEAGAHLRKEKDSLQHCHDKQLSRLRFFEQALESCRERLTSILDDWNHPSRPNLA
FT                   GTLDIAK"
FT   CDS_pept        join(65359..65529,65777..66149,66221..66336)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940123"
FT                   /orf_name="Pc17g00270"
FT                   /product="Putative uncharacterized protein Pc17g00270 "
FT                   /protein_id="CAP79314.1"
FT                   /db_xref="UniParc:UPI00018312A3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAV9"
FT                   /transl_table=1
FT                   /translation="MRPMPDRECGNRTTIIPSPTEWRTGWRLMWGMHRKGRPQGRVALI
FT                   VAGELQPVLVKLETADHDRQSSEVKKCSLTGKRHANNCSCRSTRGPGRGKSVSFPAVRA
FT                   QFSALSVEDQLQFLSWLFEGALSHCVSTRANTDAASISRSIPSQDVDISYDYPSSNTEL
FT                   DDTQSTPTRKGLPWSAEEKIPWKKQRVHTGVLEHDAQETAAIFGGRHVENAILIDT"
FT   CDS_pept        join(66963..67240,67298..67913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975707"
FT                   /orf_name="Pc17g00280"
FT                   /product="Pc17g00280 protein"
FT                   /function="ATP binding"
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP79315.1"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018312A4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW0"
FT                   /transl_table=1
FT                   /translation="MADDTYAASVMEEPDAINIEKDDPVPYEPLVGEILGEGSTSRIAR
FT                   VAPGVIIKYPRFSWWNSKTVADKWFVRDMKRSFEVEERLLQILGLHPRFKGVSDDPFGL
FT                   LFVEASDGNLQNYIDQHYASVDMSLRLKWRIQAAEAIQYIHQKGVIHSDLRPENFLLHT
FT                   VAGNELDLLLCDFGGSTNGEIDGRHLPDAGFFNPCHPPESTKSTDIFSLGSIYYTIMTG
FT                   HWPYRSPGPFKSLEEMEKYQELVDDLFASKRYPPVDGLAAGPVIQRCWTGEYSDLGALI
FT                   EDQRWQFENDTISMHS"
FT   CDS_pept        join(68571..68581,68623..68700,68740..69683,69737..69829,
FT                   69881..70158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126765"
FT                   /orf_name="Pc17g00290"
FT                   /product="Putative uncharacterized protein Pc17g00290 "
FT                   /protein_id="CAP79316.1"
FT                   /db_xref="UniParc:UPI00018312A5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW1"
FT                   /transl_table=1
FT                   /translation="MHLLHKPHPPPTLGHFWELERSWDPFSKHFSPALHFPTFRRWIFE
FT                   LGERALVAKFGQQMLRARPMRVTRGNCSQPASKPVVGCYDLGGLLKSPKKQPIYSSHHL
FT                   QKPINPDEKADFFAVLLCLINKMEPHHTNEQPTSDLQTVITGRFNNFACELTAMIESIQ
FT                   FGRLQFTGDEYKAMETASRDLAKIANNIADEVKALGKRRKAAVVAEGQKLLSQAESAKL
FT                   GVMASQKPKSLVLFVRNMQLFFNPPGESKLDSPTVQKRKQLTRERCERLRGLAPDKIIL
FT                   WAAAFAPSIWDSNVLQKSTFDFVVEFLEPGNSLSWPPHIYGILNTLVTEHPLCQSSGFK
FT                   EFLTAVQESVEAGQKVTGSCSQKAQTQQTEVPDVDEGAQEVIERAFLVPPTKLDKLLKL
FT                   HPQSTARHSIILTIPIVDRVATVLISIPREDAIRFGWESSLPVIFNASPQPTFVQSTSA
FT                   RLTLPQFDD"
FT   CDS_pept        join(71908..72332,72391..72494,72547..72665,72714..73551,
FT                   73602..73788,73821..73914,73962..74381,74433..74582)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822504"
FT                   /orf_name="Pc17g00300"
FT                   /product="Pc17g00300 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAP79317.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00018312A6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW2"
FT                   /transl_table=1
FT                   /translation="MASRKASPPCHWGLTPPNSPTNGLARPQATVEDLKQLYEVLEKVL
FT                   HNLANTQTANTPVFQDHSQPGPDVVHLKQLLVKLIDDEYCSAEPLAAAMPIQSCFASNE
FT                   QKENTEIDLESPICTTPDDFKSFEKWASKSQFKTVMETWDKEACRYKIAEPTETSNDLD
FT                   DYTKYAFVVRERVDRTSKEIVSFIDIKSEGLRDILRDVLHDIKAVSLMEIKPSIEQNFL
FT                   FHFLPELDRCAENMDSSSGHESAHAEHLLLLIDHLKHAYASTLQRLESMLRHGHITYDL
FT                   LWALFKPGCHVYTTCIGTKEPRCVVFDAGEEMTQNDETWLNLECRFLDYNGVKFGEAGI
FT                   FLRVAKFRGSKPIESLEAFPLCHHPSHEQVRKDLVERGQKFRNLAGSHVRHCKGSAFFM
FT                   NKGKAFKVNINSRVAVDAAFFHEMQPNYSRPSFRDIGVKDKDGISVIDIGAMLMEDRER
FT                   EKEKMRGDGVDAQKLSEADLLVSCPTLCCFSFKEKMFLECAVSALRDVDWSPESLDCLQ
FT                   IASETKTLLLSLAKTRLGLIPTVPFDDVIDGKGQGLNMLLNLQLTRASGPPGVGKTFTV
FT                   EATSEYFKLPLYSISAGELVVDHGDSHALESQLEIIFKIAKHFNAILLLDEADAFMASR
FT                   TELHDSHNRLVTVFLRKLEYYRGLLFLTSNRGIQFDDAILSRIHLTIEYEGLTKDFRRG
FT                   LWRTFLSKARTLQGPAVVEEEDIQRLESLALNGREIKNIAAVAHALAEADTTQVSYKYL
FT                   ELAAKSNKKFSKEFGRQGPVDGMYI"
FT   CDS_pept        complement(75195..77489)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975708"
FT                   /orf_name="Pc17g00310"
FT                   /product="Pc17g00310 protein"
FT                   /protein_id="CAP79318.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00018312A7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW3"
FT                   /transl_table=1
FT                   /translation="MEGTIAELRRQLEEERQAREDERKAREEAERRQEEEKQAREEAER
FT                   RQEEERQAREEAERHVQPNTLFTLLDRCHNSLSQAIRVETDATLTTQGDATNPVNRLYP
FT                   KRIVPWLDFPQLQEQVWRKLDRTGAFTSRPLFPSDTQIDYVVTNTQNRPIYSEASLRNF
FT                   ERDTVDNFVEMVIKALQDDECLRQEFGIQGRVTFYDRSNPSETSLENSLEQMNLQDART
FT                   PQRPANTRHGRGRGRGRGAAQRQKSAGTARRRNRRADQFCVHSVANERHKPVYAVEFKA
FT                   PHKMTIPELVAGLHQIDLAHDVIDQEGDTFEFYATRLIAAVVTQIFSYMMDSGVRYGYI
FT                   CTGEAFVFLHIPKDDPTIVQYFLCIPNQDVQADDELRLHRTAIGQVLAFTLQALAAEAP
FT                   PQEWHDAAHDKLTTWKVEYLDVLREIPQTLRKDPPASNYRPSHWKRDRKVHNTRSRAQC
FT                   QPGASTPKHSSTEGSGSDQESHSPSAAAASRSQSSRGRGKLQSARGSEGTQAGRNNKQT
FT                   SQKDGQSTRPYCTIACIRGMVNRDPLDKECPNWKLHGGQRHSVGPQEFTRQLHRQLSRN
FT                   RNHGFEQLHVCGRTGYLIKATLLLHGYTVIIKATTVDKQHLIKAEADNYRSLRSLQGKQ
FT                   IPVCLGTFTPRVSYWYHGELMAQMMILSWSGKRLQHVINDENSRFFHQERDKALTVLRS
FT                   HGVVHGDSEWRNMLWDDLSVRLFVIDLEEVKWLRRPRALEPTSGNMRHGHRVGVGKSRK
FT                   KLLSSSTAVCS"
FT   CDS_pept        join(complement(80565..80881),complement(79846..80533))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669750"
FT                   /orf_name="Pc17g00320"
FT                   /product="Putative uncharacterized protein Pc17g00320 "
FT                   /protein_id="CAP79319.1"
FT                   /db_xref="UniParc:UPI0001831361"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW4"
FT                   /transl_table=1
FT                   /translation="MPSNSTFPAIIHIRDFVEHVEPDPTRPGKGLSMQLRISLNIPWKD
FT                   IQSDDVEQDDIPTLVRFFNEGNQSDLYKPNTFVYSSGSFLTTSSDDEELFHIVLHAHSL
FT                   DRLHNLVIRAMRRYRIVFHALSRGCPPIVTFLGVVIERGGQLNGGPTLLHYRLQTTVYN
FT                   SSTRTHHTFPVTAYFKDGQRWANFPPLSINTHVFLTGRVFGLTKEHRQLAVVTDDIHFL
FT                   PAPNHQLPATPSSTGKRKRVDRWSQRAGPQTPSKSAARSQTESLPITHQSQDSPQIIAP
FT                   GDDDEESTQITWPDTPEEIKASSRATTPVPERRSQRPRKTSYADILAQSKYDS"
FT   CDS_pept        join(complement(85748..87483),complement(83171..85700),
FT                   complement(82854..83139),complement(82125..82805),
FT                   complement(81573..82048))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940124"
FT                   /orf_name="Pc17g00330"
FT                   /product="Pc17g00330 protein"
FT                   /protein_id="CAP79320.1"
FT                   /db_xref="UniParc:UPI0001831362"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW5"
FT                   /transl_table=1
FT                   /translation="MTSSAPNLRCSSCKRPWQQSLYKTCEACRQKGHRHWRRHRPLATA
FT                   DTPSPPSTQSVLPYTDLPSSSPRTFCSQCCRPWQSARYKTCDNCRQKALPHKSRSRVLP
FT                   TTENQGVSIEPVDNVRDGFPGRILPASTATRRLAPLLRHHAKRQKIIDAQPRNVDDSLD
FT                   KALGFLRNEHERHATASQSFPPEITSTDIRRSVSGYEEATSTASKRSVCSSCGKVVPEA
FT                   EIFPVDDGDPLLLPLGGALDRCGQHGSTWDVCSSCHAALIRGAAPKFSAKNLVNVTLCQ
FT                   DYPSALAELTLVEECVIARCHPLGVIVKLRPGGRRSSISHRALRGHFIVIPQDPGPLLQ
FT                   ILPSPSLRLDSLIKVFWLGDRPPTDADLSPFLIIRRVKVLAALQYLVRNNHLYRELSIN
FT                   HSMIDNWGDEFIPLELRDNIIRLDEPDHHEREGYTVSLAQGNYENDLQAAQSESFHSND
FT                   CGLFLTGSVSTDINGERQNPDTRMLHTLLDVVGGRSCTSEQDLERTDPALACPRAGQRI
FT                   PVISYTTRGQVALMDHWSDPHYFTAAFPTLFPKGVGGHLDERTIPVSLSALSEWALSHH
FT                   SRRFARHKTFMYLLFDILQLRRSSLGNAFLVKRRHWRSAAHDIASLTVDQLEKAAQDVK
FT                   AGQNVEDPVIRRLQQHIVTIGMRVPGSFSQKLRMRSEIRGLIVRHGMPAFWITINPSDL
FT                   RNPLVLILAGVEFPVDDLGATNAAIRDAVATSNPVAVADFFHCVCQAILRGLLATDTGH
FT                   IGALGDLSNHYGVVETNGRGMLHMHAVLWVRGNLAFTTLRNRVLGDTEFAARLIRYLEA
FT                   TIVQGIDESVPHDPEVNLPSTPPSAKERETDAEFFLGLSYDSNSVARRTQIHSRHHHST
FT                   CFKYRQRGPGKDACRFGMPRDLVPTSKVDEFGLIHLARNHAWTNPWNPAIASCVRSNHD
FT                   ISWIPTVSKSLSLIYYITNYATKDDVSPWQMVAKAALLKQRIERAEAAELPTRTDLRLR
FT                   DKGLDNFALRCFNTLSHGREISGVQVASTLLNLPTHYTINYNFVRINLWWLRRYIRDLI
FT                   QPVNIDVGESSDPMAEEPCTYEAGGTAPVSMFDNYRWRGPQLERLALFEYCMLVRIKSV
FT                   RDATTDDVDFDLSHPQSNTHVQRLAHTSSQVSTVTFNGQLTEFQASEDAVPGGHPKTAA
FT                   NMNDLAEMLLGLFVPWGQLPALFQEHANAVPIKRDACSRIWEVIEPTLTPHVRRFAPNI
FT                   ELLRKSREDSLADAKLQEAPVRVNGLIDRDINELEIDNFASDSDDSFANLDESVNVETL
FT                   IAAYHSIAKCWDHETLLAGRRIPSLIHAPTHNQGQPLQNLLPLNLFDSPAYSASGLSFF
FT                   PPSTLQQWESRLKELAKFGEHGDVYHSVVGEAYDLDGFSLDIGDAILEPMLNEPEVIPT
FT                   LADQQSYVEDSSSPTSLTLLRLVVEKVLGEALDWASHPYDASKRHQTLLYVGGEGGVGK
FT                   SQIVKGIMAGMDLIRRKKEVILMAPTGAAADNIGGNTFHTSLGVSITRSTGHSMAALSM
FT                   MDLSMLSVINNHCKMARSLDRGSRDFFGALPIVILMGDFFQFPPVRGPALWKEPRSGNA
FT                   EDEEGRLIWHQFRNVIILDEQMRQSGDPSFRGLLHRARTSTLTEEDLDLLNSCVITSLV
FT                   APQLHGATTVVKLNSLRHQVNRIRMEHFAKSCCQKIYAFPAQHTRTKSTGPTNLRLRVD
FT                   DLLQQPDHGTRIPFPGMFLYTPNMPCVILTNVCTRLGQVNGATGTAIAEFYEIDDLYIL
FT                   CTKPPACVLFKQDKSTTSVFEGLAPATVPVFPLEKSITLKGYSVRRKQVPISPTFSLTD
FT                   YKVQGSTLDSAILDLRDDSAIRGRDRHQKFCSTYVQLSRLRTRKGLHLLQEIEMKDLQF
FT                   GPDPRILAEMRRLEKLEKATLDAWKHSN"
FT   CDS_pept        join(88410..89546,89581..89666,89752..89811,89859..90036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940125"
FT                   /orf_name="Pc17g00340"
FT                   /product="Pc17g00340 protein"
FT                   /protein_id="CAP79321.1"
FT                   /db_xref="InterPro:IPR018818"
FT                   /db_xref="UniParc:UPI0001831363"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW6"
FT                   /transl_table=1
FT                   /translation="MTSKHRGHEPNILEFNELAPDFLFLIMVSQTNSRIVMAVAGKTAS
FT                   VDISPRRAILSGGHVSTPPGQRAMLPTPPNSISPTLAPQAFKQGVTLSPGSPLSTVPQL
FT                   NSDIDLQDAVQNDNSQNVQPANDLGSTGAITPAMLAKYYLPDIMLEQGPLAIRHIMGHL
FT                   TTSVPGFSTIPPAKARRLVIAALKGRGNGGEADGIEGDVVCEKISCGRWDARRRGEPAH
FT                   DRDLNTSASPPSRLAGSLQQRGLQIQGQTGWQGGSRSPCRSPYRQSFAESTSETFSYTN
FT                   DYGMRSDLDMLEYGADKMSLDGDDGKCCSSSDAPDGMQENEWAEDDDTDGEDWAKIGAD
FT                   ALRARAVHNNGGFTDGHFAARAIFKPSGTFPAKCPSPAAERAPSRTKITALELIRREGK
FT                   KLARIEGSRNNNTHNNISMDRYRLREKQCLVTSPALSGPAESYIISAAAFNPGRSSAIF
FT                   RLDLLVVPENSPDVNGKILCREVSRGSW"
FT   CDS_pept        join(complement(92595..92750),complement(92276..92371),
FT                   complement(92145..92198),complement(91903..92061),
FT                   complement(91740..91824),complement(91515..91622),
FT                   complement(91242..91347),complement(91070..91158),
FT                   complement(90917..90981))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822505"
FT                   /orf_name="Pc17g00350"
FT                   /product="Putative uncharacterized protein Pc17g00350 "
FT                   /protein_id="CAP79322.1"
FT                   /db_xref="UniParc:UPI0001831364"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW7"
FT                   /transl_table=1
FT                   /translation="MDRGSRLVHLKADRLSLLEWKKHSPESPNLYANSSFKRIRRVSQS
FT                   VEPRHEAATKGQCRQIPRDLLRWGGAKLKRCWVTSTMCGALDPLLNQVQRLICSKRLVF
FT                   SPIVDEEPFDLGAELSVHPGLELSKLLERFILPSDGICPRAKRIIASQGDHTWSSCTGV
FT                   PLLMPLTDMHAGRCGIAAAVVAKKCFIVSTIFNWRTTPLTSECGISVPHYAIAGPEVIV
FT                   IEESGYPNNEFRVRPMLRDLEETLKVRDHGSPSMAIFGLDIKIRRIQKSLAGLRISYNT
FT                   ARPGILGRLAHCRGTFRYPTTRPR"
FT   CDS_pept        <92929..>95556
FT                   /pseudo
FT                   /gene_family="HOG000213034" [ FAMILY / ALN / TREE ]
FT   CDS_pept        <95557..>96054
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(97637..97651,97707..97890,97950..97966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217495" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822506"
FT                   /orf_name="Pc17g00380"
FT                   /product="Pc17g00380 protein"
FT                   /protein_id="CAP79325.1"
FT                   /db_xref="InterPro:IPR020100"
FT                   /db_xref="UniParc:UPI0001831365"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAW9"
FT                   /transl_table=1
FT                   /translation="METVKNAANYVQESVQGTGAEASKETNKNVAKDSDASLTSRATAA
FT                   KDAVVDKKDEKSHDAKADVHKEAAKN"
FT   CDS_pept        join(98967..98981,99073..99191,99382..99413,99473..99489)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217495" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940126"
FT                   /orf_name="Pc17g00390"
FT                   /product="Pc17g00390 protein"
FT                   /protein_id="CAP79326.1"
FT                   /db_xref="UniParc:UPI0001831366"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX0"
FT                   /transl_table=1
FT                   /translation="DDVSNNHDLTVNDPSEEGGPEVETFNITHRSTVDGSIINNGTPQA
FT                   NGGLALSPTQTTNHPNSPTLAPSSYALYLRDRPAGQGVLTAMPRDEDVLMSLQLLAYVS
FT                   KYCNLRSYFQASHXXPPKFAAIHYPVLVLYRFFLLSFFSVLGKTKWMAHFSLFVSYRPL
FT                   MGLSISQQNTYSDLPNSDLYLCGLCLALWYQLNKDQ"
FT   CDS_pept        join(100172..100263,100432..100535,100705..100796,
FT                   100834..100977)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669751"
FT                   /orf_name="Pc17g00400"
FT                   /product="Putative uncharacterized protein Pc17g00400 "
FT                   /protein_id="CAP79327.1"
FT                   /db_xref="UniParc:UPI0001831367"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX1"
FT                   /transl_table=1
FT                   /translation="MLLQIVAVKRRHGSQQPSIKIGILQRFLSSLVHRGPASQTVSVGD
FT                   VVPQQIHCAIQTNRSKIRDLDAEQLDPWTMHPCKGHSSLSSLHPWFRRPEHLTSDSEPM
FT                   IAYVPECPPPRSSATVSAPRKAMAYALFQTPGFEQCSMP"
FT   CDS_pept        join(complement(103993..104316),complement(103719..103760),
FT                   complement(103516..103532),complement(103243..103459))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940127"
FT                   /orf_name="Pc17g00410"
FT                   /product="Pc17g00410 protein"
FT                   /protein_id="CAP79328.1"
FT                   /db_xref="UniParc:UPI0001831368"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX2"
FT                   /transl_table=1
FT                   /translation="MSVDVSVDVSVDVSVDVSVDVSVVVSVVVSVVVSVVVSVVVSVVV
FT                   SVVVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVVVSVDVSVDVSVDVSVDVSVDVSVD
FT                   VSVVFIDATGRHYIMSGFYYRTYTKRPMGPLNATGHGQPGSNSVRIHGPHGPWRGLSMS
FT                   HGRSTEVFLPSHPHENVSITIDSISQAISSSILITR"
FT   CDS_pept        104839..105678
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940128"
FT                   /orf_name="Pc17g00420"
FT                   /product="Putative uncharacterized protein Pc17g00420 "
FT                   /protein_id="CAP79329.1"
FT                   /db_xref="UniParc:UPI0001831369"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX3"
FT                   /transl_table=1
FT                   /translation="MTRRKAQSTTIPSQSQKLVPRQPWHRWTDEELNLLAYCRTRHWSY
FT                   DRILRKHFPLFTESSLWGAYSRIPPKERAHRASIFARSITTSRTAPRNKDSTRPHPVPE
FT                   TDHRSHPAPQPEANIGVHKSSASRGEEDNQTPIPIDGTNRYNFRPNRYRSFQESQTQYP
FT                   IDRLRFPRFFRSYKNHLKLDGVPDGDYAPPPHSPTPDLSDRSPSVISSLPSAASSLELF
FT                   GLEARSLSSSDRDSLVTPSLPNEGSSPVQLTGASVSWSSKRQGRWPLLPLTPSMFQY"
FT   CDS_pept        join(108784..108927,108990..109093,109146..109268,
FT                   109328..109460)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940129"
FT                   /orf_name="Pc17g00430"
FT                   /product="Pc17g00430 protein"
FT                   /protein_id="CAP79330.1"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000183136A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX4"
FT                   /transl_table=1
FT                   /translation="MPLTAISMPITILTRFMQWSSAVIVMGITSYFMHNWPKGQHTIYQ
FT                   EVISTISVALFLPAFVSPFMPNLLSKFVTPIDIIFSYLWLTAFIFAAQDYNWKDCSQNA
FT                   PPGASCALKKANESFMFLAFFFTILAIFLELFNLWSHRKESEISEDRKHDAHSPHNGPS
FT                   DTAA"
FT   sig_peptide     108784..108849
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX4 "
FT   mat_peptide     join(108850..108927,108990..109093,109146..109268,
FT                   109328..109457)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX4 "
FT   CDS_pept        join(110723..110783,110842..115055)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975709"
FT                   /orf_name="Pc17g00440"
FT                   /product="Pc17g00440 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP79331.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000183136B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX5"
FT                   /transl_table=1
FT                   /translation="MSALVHDSPDRAVTAIEPLTGLGCSGGRPSASRLSIQVRQTHYGG
FT                   YPPLGGAPPQRGVRQRAIEARLEVEVQAFERHRERSRREAEAYHTIFRYLSPHISIHVA
FT                   GLETSRDLWNELEERYRRMELATFCELFAQLRETTGERCGSAREFVDRVRLLVHRLNAI
FT                   VPGSIGDRAHIAILLTQIGPEYVLIVDAIQNDKDPVNPTTIGNRLSNAEQTVRRKESPT
FT                   PVQAASGPSVNTVQQTAKKYNYCKKRGHVVAQCWKKQREAQPSRDHALKAERSVSGSPR
FT                   NSLQNIPSSQVEDRQGPPTSKRPRINIVRAXVTTLYTHAPQPRWILDSAATSHICWDRS
FT                   CFSSLRPHREMLDTAGDPVEAEGXGTVKLTLRGKFNQPLVLKNVYFAPRVGMNLISVPK
FT                   LLRDRYSVVAHPQNVFVQRRGRTVGTAYHAEEDLLILRCYVSKRSRERVQLARAPAAHG
FT                   HADSLELQAVAMDVDDPRESSDAECAASTSELGGEAVILEEDACKGVDQASEALWHARM
FT                   GHLNRGDLRVVLRQTGTPYRPLTQAQLLATPQCPACMSGKQHQKRNSRARRPRLHSTRI
FT                   FEMIHSDIMEMPIAKDGSRYVITFTDDYSRGSWAYAMRRKHEALQKFRQFEAWVYRQFG
FT                   AQIKRFLTDNGREYLPVGTHLESQGVEFDTSPPYCKGQNGLAERTNRTIRERINTLLSD
FT                   ARLPPSWWTELLETVVYLKLRAPASILQKKTPFEILYGKPPSLLHLRRIGSRAWVLIPK
FT                   EHRAKLGPRSSECRLLGYCGPNQYKLYEVHSGKTVFSRDVEFDERTPVAPPIEGETGND
FT                   LPDNAPPSRVFPPAVPSPSSASPGPPASPPDSAERPKTPSQRVEEALPPVNPIEQEAEP
FT                   TQDLGYSIYGRRRRPSRRLLESLGKVYTAGTLRAASASTVDPSTFHEAVSGPNQLEWWA
FT                   AIQKEYASLLEHGTWERVRREDVPAGDHVIGCKWVFKTKANGTRKARLVIKGYRQKHGI
FT                   DYHETFAAVSRMDSVRCIVASTVLRGWKLQQFDAVTAFLHGDVDSSIYMELPEGFEEPG
FT                   YVCRLRRSLYGLKQAPRIWYQCVHRVLASHGFTMAQSDNCVFYKPDCVVCVYVDDFLVA
FT                   AANTHEIEQVQRALQTEFRLNDLGIPRSFLGIQFDYHVDGSVSIHQHQYIQKVLSDFGM
FT                   ESCQPKSTPMNPKQILNHRPDEESPDEEAKARYATAIGSLMYLMVSTRPDIAFALGMLS
FT                   RFTSQPQSHHQVALQRLLRYIKATQSRRITYRSGQLIGYTDADFGGSVVTDGAYSTSGY
FT                   VFQLAGAPVSWSSKRQGEVATFTTHAEYIGQYNAILHLQWLRTFLAETQLYRSPVTNIM
FT                   ADNQSAIALSRNPEFHKRTKHFNVKFHYQRAVLNAGEIGFQYIPTEKQAADGLTKPLGP
FT                   TAFAKFCSLLGVDASETPRQHA"
FT   CDS_pept        115763..116311
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940130"
FT                   /orf_name="Pc17g00450"
FT                   /product="Pc17g00450 protein"
FT                   /protein_id="CAP79332.1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183136C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX6"
FT                   /transl_table=1
FT                   /translation="MRKICSRIRNSLLHAPAGTGEQLDENVVNRLVNAYDDFKTFSDVN
FT                   PMLRLLAADPNLREFVFFNGTRTIISNSVFRSKDLSPRANVFEDIIFVHVVKWYKLSQA
FT                   SYLHLAEQTVNGPCQMRKLWLISSNPFDIVGARSMGMNAIWVDRAGVGWKAAVVPDLQP
FT                   TATVNSLEHIVEEVRAHRE"
FT   CDS_pept        join(complement(116884..>117357),
FT                   complement(<116415..116810))
FT                   /pseudo
FT                   /gene_family="HOG000215712" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(<117871..117895,118047..>119212)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(121196..122012,122048..122724,122782..123517)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(125288..125404),complement(124837..125241))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940131"
FT                   /orf_name="Pc17g00490"
FT                   /product="Putative uncharacterized protein Pc17g00490 "
FT                   /protein_id="CAP79336.1"
FT                   /db_xref="UniParc:UPI000183136D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX7"
FT                   /transl_table=1
FT                   /translation="MESPNSSPDQEKGEQQPSELAILSDMNNNLESSDHVPSSPSTSQH
FT                   EKETRHTFATKPFQPIFKVLVDLERDDPKFAFPAARLVGLYRCLWESCVSKHIDGEQLE
FT                   QSNQVLKEAGAHLRKEKDGVQRCHDKQSRPRFFEQALESSRERLTRVLDDWNHPSRPNL
FT                   AGTLDIAKQG"
FT   CDS_pept        join(complement(127291..127467),complement(127097..127200),
FT                   complement(126977..127012),complement(126822..126889),
FT                   complement(126642..126728),complement(126320..126385),
FT                   complement(126153..126250))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975710"
FT                   /orf_name="Pc17g00500"
FT                   /product="Putative uncharacterized protein Pc17g00500 "
FT                   /protein_id="CAP79337.1"
FT                   /db_xref="UniParc:UPI000183136E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX8"
FT                   /transl_table=1
FT                   /translation="MVDECVAMPEVQELHNSVKAVGTRAEDAMEHARRPATLVLSPIRR
FT                   NRPLATVYFTVDDGALDLTHLSMEMGVSRFYATKFASGWPHPVVDSLSCTDGSAGLSGP
FT                   LWDEETARSCGPCTGALWSNVHGSGYIQRRDIRSAQSAAIAETSLHRHFNSLTGFSASD
FT                   THKLERKRWTPILIEGLRETSKSGVEKRDAESVKKRCLTVESFTALLN"
FT   CDS_pept        join(complement(128944..129144),complement(128826..128893),
FT                   complement(128632..128704),complement(128375..128512),
FT                   complement(128226..128282),complement(128067..128141))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975711"
FT                   /orf_name="Pc17g00510"
FT                   /product="Putative uncharacterized protein Pc17g00510 "
FT                   /protein_id="CAP79338.1"
FT                   /db_xref="UniParc:UPI000183136F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAX9"
FT                   /transl_table=1
FT                   /translation="MLLRALDKQAIKNTRSAPSTMPRQRQIIFQPISRIEVTAIAFREV
FT                   LSQVHAINHALLLKEHGISPIGEYQFARSRSRHFGRPSESNHHMSDMPMCPPQPDELVE
FT                   YIIYSQRTVEGKWSAHSASAWIGNACIRIIFTRHLSNRVLHNSFDSPHDAASCMLEAKN
FT                   EETLRLLLLAGGLVLTAWKDTKCHPRTTSITHSTPAAYAA"
FT   CDS_pept        join(131556..132095,132138..132506,132574..132887,
FT                   133266..133688,133746..134050,134083..134343,1
FT                   34432..134436)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822507"
FT                   /orf_name="Pc17g00520"
FT                   /product="Pc17g00520 protein"
FT                   /function="DNA binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP79339.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001831447"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY0"
FT                   /transl_table=1
FT                   /translation="MSESQASLFSDQFSDAGFLRSDSFPGLPTNSRTVDSTPLSELTNS
FT                   PQYTRAPGSLERVGPRFREFWTLWKSGDEMENYRKDFTDWWMGTEFGSQEDVSESTHWD
FT                   GRKKNSELWESFEQVAHEKTGEPKVMCKHCNTLLVHANYRRKGSSPMKGHLASEVCHYK
FT                   RSKASDTPKTNDILRSLTTTIAITKPQSSAKRTFSQELLLEKLLTFITCAQVPFRIIER
FT                   PGFMDLMDVIQVAQSEIDLPSARTARRFLDITVQKQQQTVLDRLPPRSRLSIALGCWAS
FT                   PFRQAFMAITVYFLNQDWEYREILEERGIAERVLSITTDNATNNNTMMMSVQDTIQSQG
FT                   LSNASVFRIPCIAQVLQLSLHQLLGKMKVEPGNNQAETEWSDERTHSLHSRRSTREIVD
FT                   TLNKVYYLCHPEAADRQLQRKRVSWEKVMLEALTAARTKLSEYYTATEVERYGGFYGMA
FT                   TILAPSKKLRFFTTKDWQGHDYAKQYRKCLEEGLKRYKQELSKENTPVTVGALTDSPGL
FT                   NNVIETLLDPQTSLLPESDEDDDDEIARYLARTSGLNPAHPRAFWGEHEHEFPVLANVA
FT                   RDVFSIPASGAGAERLFNCARDICFYRRSRLRPETIRELMLHRCTSKFELEQGEIDLAK
FT                   EYISTGGAAAIDQERDEPISNEDDEEEEEEEEDDEDELPATHVEIQAAPARQKRPRSST
FT                   SESLNDLELPEMPTEGKETQGRAGRKRRPPSLPDGFEIDNCSYC"
FT   CDS_pept        join(complement(138586..138852),complement(138155..138517),
FT                   complement(137330..138079),complement(137161..137274),
FT                   complement(136977..137111))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975712"
FT                   /orf_name="Pc17g00530"
FT                   /product="Pc17g00530 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP79340.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831448"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY1"
FT                   /transl_table=1
FT                   /translation="MGLDNHPHTVQQGHSSQYAQNDPECQGLTQTRSLLALYSYPDSTS
FT                   STPSNTRDNPSLDAGLENKQTHGEHDKETAKDPNLIEWDGPDDPENPQNFSTCRKWLIT
FT                   IVLGMMTVSVTFASSVFSTASSVTAERFGVSQEVMVLGTSLFVLGFAFGPIIFGPLSEL
FT                   YGRKKPLIIGFYTFAIFQIPVAVAQNLQTIFVCRFFGGLFASAPLAIVGGMLADLFGPV
FT                   DRGIAVAIFAASTFIGPVAGPIVGGFITMSYLGWRWTEYITAIMAFTFGTVGLFVVSET
FT                   FAPTLLQQRARKIRFRTKNWAIHAKADEHEVGLKHICYAYLLRPFMMLVLEPILTLITL
FT                   YMGFIYGFLYLCFEAYPIAFQEQRGWNPGVGQLPFLAITVGVLAGCAIIIIFTKTRFQA
FT                   KLKQTGQVVPEERLIPMMIGGLLLPAGMFWFGWTSSPNITWVPQVISGGLLGAGVLLIF
FT                   LQGLNYIIDVYAMNSNSAIAANSFFRSWLGAGFPMFATAMFHTLGVDWAMTLLGCLTAI
FT                   LFPVPIIFYYYGKKIRSWSKFSPTL"
FT   CDS_pept        complement(<139426..>140582)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(142461..142627,142734..142995)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126766"
FT                   /orf_name="Pc17g00550"
FT                   /product="Pc17g00550 protein"
FT                   /function="signal transducer activity"
FT                   /biological_process="two-component signal transduction
FT                   system (phosphorelay)"
FT                   /protein_id="CAP79342.1"
FT                   /db_xref="GO:0000160"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniParc:UPI0001831449"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY2"
FT                   /transl_table=1
FT                   /translation="MVDDELNAKLKQVIEMAVFSQMLEMDDHEERTFSSSALYGFIETS
FT                   ENTVEDMDEAFSKGDLQHLVSLCDSLRRFASATGFYEVRECCGNLKEGGVMSSGDGSAS
FT                   VGVEVFCLSRIKGGIGTLRDSICFARRAIDSFYKGNVK"
FT   CDS_pept        join(complement(145869..146067),complement(145781..145805),
FT                   complement(145648..145728),complement(145468..145606))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940132"
FT                   /orf_name="Pc17g00560"
FT                   /product="Putative uncharacterized protein Pc17g00560 "
FT                   /protein_id="CAP79343.1"
FT                   /db_xref="UniParc:UPI000183144A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY3"
FT                   /transl_table=1
FT                   /translation="MLRTNSVPWHVSPARPAVLTLVANVWAGVQDLTLKYLTLSDEVDD
FT                   IHCVFCLAKDEDLANESVSLRCFGTSCCVCRNEGPLDALIRPLRVQSSDARHIISTRNS
FT                   SPNDPGQSQPRQRSVGPQGRSQWDPKGDQSSRVWRMVPVARLG"
FT   mat_peptide     join(complement(145869..145986),complement(145781..145805),
FT                   complement(145648..145728),complement(145471..145606))
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY3 "
FT   sig_peptide     complement(145987..146067)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY3 "
FT   CDS_pept        join(147305..147307,147360..148320,148409..148961,
FT                   149098..149179)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669752"
FT                   /orf_name="Pc17g00570"
FT                   /product="Pc17g00570 protein"
FT                   /protein_id="CAP79344.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183144B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY4"
FT                   /transl_table=1
FT                   /translation="MPNIRNLPNELLLCIVSHLDGSALFALTTSCKNLYFRLQPSIWKY
FT                   NIRFQNSNLLHLAVKYDNVGFAEALLQHNANINAFYRGKTPLMRALKYSSAAVRELLLS
FT                   RRDLDINIQNQARDSALSYAIHYGSFSIVKSVLEHHAARVDIKHKNGRTALHLAVFAGR
FT                   IGFVQLLLFSGSDPNLEDDSGQSAWSWACRINRPVMEMIFTNGPDPEAYLGTRNAQDSE
FT                   LPLHEAVLHGSIDAVKWRLRQKGLNLGIQDRKGYTPLHLAVQSRRLEVVNLILSHPLAN
FT                   VNCKDKDGNTPLWLSSYSPCDEITERLLAEKDINVNFIGGRIALNLCVAGHSPISVAAY
FT                   HGHVNMVACLLSRKGVEINGRGLIDPPICRAVAHGHLEVVRLLVQQGGARLNINESTIE
FT                   THDTALCIAARNGELEMVQALLRHDQIDVNLRNRWFEDPLMLAVKSGHFSIVDTLVVNP
FT                   RLKHFSLKRSLDLARDDCIQRAIRTRMEDDNSRQGLLKRSPRRWFGRLLLKLGLSQNLR
FT                   DYPQTHSTKAIICPS"
FT   CDS_pept        join(complement(149667..149786),complement(149369..149620))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940133"
FT                   /orf_name="Pc17g00580"
FT                   /product="Putative uncharacterized protein Pc17g00580 "
FT                   /protein_id="CAP79345.1"
FT                   /db_xref="UniParc:UPI000183144C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY5"
FT                   /transl_table=1
FT                   /translation="MDSPNSSPGQEKEGGQQPSELPVLSDKDNSLETHDHVPLLPSLLQ
FT                   HDEETRHTLAIEPFPPIMKVVRVQAHRWPKATAEQSDIEGGSYAPEKREGRSSAAPREA
FT                   ASSTALFRTGIGIIPGTTD"
FT   CDS_pept        complement(<150998..>154263)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<154389..>155711)
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(<155930..>157103)
FT                   /pseudo
FT                   /gene_family="HOG000234520" [ FAMILY / ALN / TREE ]
FT   CDS_pept        <157106..>159676
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(160098..160595)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076700" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940134"
FT                   /orf_name="Pc17g00630"
FT                   /product="Pc17g00630 protein"
FT                   /protein_id="CAP79350.1"
FT                   /db_xref="UniParc:UPI000183144D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY6"
FT                   /transl_table=1
FT                   /translation="MRFALFLLLAPLATASPLLDTTTEVTDIDVATSLDELTAVAELVD
FT                   NSSILEARGSTPWHNCKCINGYITDENYSGVYDKSLAYDGNWYWGIPDVPQGFGVYFEG
FT                   PNKYFLTVEVKGKDSQLLTKNRVGNIIHQLKVARGDKHCGTKPVVCWTKGDNEIKAYVK
FT                   EF"
FT   mat_peptide     complement(160101..160550)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY6 "
FT   sig_peptide     complement(160551..160595)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY6 "
FT   CDS_pept        join(161705..162290,162415..163457,163522..163653)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822508"
FT                   /orf_name="Pc17g00640"
FT                   /product="Pc17g00640 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP79351.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000183144E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY7"
FT                   /transl_table=1
FT                   /translation="MSDEFPPLAPLPQLTLHPSTDPSQIDAPKMVNAWLTTLTTALTAN
FT                   QPIILTTHFLPDHSWWRDLATFTWDIACHNGSEAISKYLRSSTSGFTEAVADLPGALAP
FT                   HLEDMGGMKFIQSGFRFKTRVGKGRGVVRLANVGPEEWRAWTVYTVLERLDGQDEVEAR
FT                   REKEQSTLSSSSGAVLASTRGEGDVQVLVIGVDKTSRVGDSWRNRYETIKLHTPSYTDH
FT                   YAFLKFPTNWPRYPNQDQIANWMEHYAAIMELKIQHDTEAKKIAYDESTKKYLFELKGK
FT                   DGITWTITAKHAVLASGLFNDNIPVRPTFAGEDSFKGEIYHTTAHKSARFVPELQGKKV
FT                   TIIGAGTSAHDIAQDFVKHGAKSVTLVQRGEIYVASLGALEEVSLKVWNTPGVSTEDAD
FT                   LLGSSFPWPVVRTLSVGASQMMAAIDKDMLDGLEKAGVALKRGDKGDSLVDHQFIKGGH
FT                   SYLDQGACQMIIDGRIKVRRCEKGVQGYYPEGIILADGTKVESDLVILATGIERGEKVV
FT                   EQIMGKDVVDKVGGLFGLDEAQERIGTWRPTGVAGFWFTAGSFAFSRQYAPTLALQIAA
FT                   AEWGLSDKRE"
FT   CDS_pept        join(complement(164992..165132),complement(164679..164935),
FT                   complement(164086..164599))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940135"
FT                   /orf_name="Pc17g00650"
FT                   /product="Pc17g00650 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP79352.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183144F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY8"
FT                   /transl_table=1
FT                   /translation="MTSQSGHGLLRALAPFPSDHPPTASQPVPRRAKRSNACTACSARK
FT                   SKYAGSRTCDECVGTGSSCVFTVTLDRRRKYAQRLAEQKLNTAQQLLDKIIVAFDTGDS
FT                   GQLRSLLSTAKSLAQGKQLRMLLLKTLRRQDQAIKYCIGSHLARYGPAVSEPPSVLLHP
FT                   VLDQTRKQPCRTILTSYNRDQKTKEPFQMDDRTPVLVEKMLEFQYPRKDTIGRDTAGAG
FT                   DAQLDSNAGLGVNRERAEETSMNYTMGERDSNELVAEMDAATNENVMPSPDNAALDIMD
FT                   EFPPDERRTRIAPGLENLLKMA"
FT   CDS_pept        join(166075..166192,166275..166561)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669753"
FT                   /orf_name="Pc17g00660"
FT                   /product="Pc17g00660 protein"
FT                   /protein_id="CAP79353.1"
FT                   /db_xref="UniParc:UPI0001831450"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAY9"
FT                   /transl_table=1
FT                   /translation="MEKRRFSGSISQSNCLRLKASRQSAIVQHEAQVAPSRRPVACFYI
FT                   RFPDNYFHHVIYIPERTICELRDQIMRKVQVRTRTIFHRNGAGPNILVDNEFVRQFPDR
FT                   QVMIAEFLDTVNIDRDIDVTLKYQGIRHLS"
FT   CDS_pept        join(complement(169954..170192),complement(169717..169908),
FT                   complement(169505..169659),complement(169169..169455),
FT                   complement(168980..169101),complement(168315..168920),
FT                   complement(167805..167937),complement(167517..167759))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940136"
FT                   /orf_name="Pc17g00670"
FT                   /product="Pc17g00670 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP79354.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831451"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ0"
FT                   /transl_table=1
FT                   /translation="MWPTHAQKSSHSCLSCKEKKRKCDRNLPVCSRCQRCVESHPSRLV
FT                   AFLAFGMLTQDLDVRLDPTVDACFRTISSVSMRVEFICKHMIHFPVALILLGIRMEHKY
FT                   LDARTSPSESPPEPSKACYHCRRLKKHCDTTQPICARCTRLGIACMHNGLIERDVQRIH
FT                   DPLFSNPTTDSVNYTLNYPIESRVHVPMLIRFFQDKLGLSPFQVEADSLAYYLRSTWIS
FT                   YALSDPCLLHATLFSASVQFDALTGAQQPAYATLYHQFKTINLVRSRLADLSSPNDATV
FT                   ASVLLLAMHSSLQFDQNLAQVHCRGLMQLIAARGGLDKLGYDGFLAQIIQGSLTFLAIF
FT                   FDQAEPFPIPGMPRTAPSYTLISLILIGSNKSPSQHLRYRLLILFQNINQLLHEEYANT
FT                   EARTRTTMNNPRLRDLLDKLWSEGDPSLLNSHQPPGLPKKELALLRTCVISGRVLAYLL
FT                   DDHLPWSEGALEQLLEQLTEAIRKTERATWVKHGPEANMWVAVMGAAMVNDVNKRASFL
FT                   LKENCVASSTRDTQPSRINVVVCLDIEHQKSKQATISTWRPDYRLEAGKEVFVAAVVVG
FT                   QKVFRARDGRPLDTDPLRLNLKDFATRNLTEDYPDIGRHEIVTPSKMLHYFLLQAEKRT
FT                   ETQKQHRGATNSIRPGVLIVVDR"
FT   CDS_pept        join(170286..170382,170480..170569,170663..170751,
FT                   170863..170931)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940137"
FT                   /orf_name="Pc17g00680"
FT                   /product="Putative uncharacterized protein Pc17g00680 "
FT                   /protein_id="CAP79355.1"
FT                   /db_xref="UniParc:UPI0001831452"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ1"
FT                   /transl_table=1
FT                   /translation="MDTTGKEKNGRSPHNGTHDRGSHMARTAPALPSSLNLGYIVVVEH
FT                   LSTIEHMSPSVVSLTRAASGPSTPPPPLRPLVQPYGSEFLLSLGVSKESCKTAKYGVTA
FT                   FYGLLRIPNQ"
FT   gap             171016..171115
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(171200..172185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975713"
FT                   /orf_name="Pc17g00690"
FT                   /product="Pc17g00690 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP79356.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI0001831453"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ2"
FT                   /transl_table=1
FT                   /translation="SRNSIEREGRILLAIKAIKNQEISAICRVARRFEVPELTLRSRLY
FT                   RTTFRANSRVNLYKLIEIKEETLXKXILSIDSRGLAPRPSIVREIANLLLEKRGTTPVL
FT                   SVNENXVTNYIKKRSLLSSRFSKRYNYKRAKYKDPEVIKGXFNLVXKTILXFRIDLDDV
FT                   YNFNKTGFAIGLTAIVRVIIRSEYYSXRALLXPRNRKYVIVIKYTNTTSXALLLYLIFK
FT                   GKVFIKSXFDSLLSVXRFKVSPNSXTTNKIRLRXLKKLFIPSTIYIKGVYXLLILDSYK
FT                   SYLIPRFNKSIKKNXVILIYIPLYLSYLLXPLDIGYFTILKRAYRRLVKFRIRYGSNYI
FT                   DKLDFLEAYPTIRIEAFKLETIKNSFXSTGLVPFKLDRVISKLDIRLYTPTPPPYSXGS
FT                   NXDLKIPLNYRXLEKXAFSIKVLLRTRLKTPLSPLNSAINQVLNAYXITIXSATFLERE
FT                   VSDLRGENEKKKQKRARSRKYLVIYRERSLSVRSIYANYIAGGSSXTRSRLVXXISFIT
FT                   AYKTPLGVRSM"
FT   CDS_pept        <173207..>173454
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(174158..175357)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940138"
FT                   /orf_name="Pc17g00710"
FT                   /product="Pc17g00710 protein"
FT                   /protein_id="CAP79358.1"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="UniParc:UPI0001831454"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ3"
FT                   /transl_table=1
FT                   /translation="MPQSKFSIPAEFRDQLEVAEPLDSRSDEAILVSLSKHKPVTSEKN
FT                   IWAFWHAGAAAMPQWCQRNIIDWHRICGPSWTIRVLDTVPNSPNHALKYIRPELLPETF
FT                   VKGTMDGPYVGPHSADFLRGASLYMYGGVFMDAGIILTRSLDRICWPAIADPTTPYNVA
FT                   VPWMYGTVMANHFVASRKGDPFIQRWHELFVHVWKDKNSYKGMTENPLLSFALKQDFSA
FT                   SVARGFKWEFIVDPLTVFEYITQVVAWQRLCLLEEAGDGFSCVDYAGENIMWFDVLEEN
FT                   WGFETIAGFTGQEAFDVLATRLDADSESEEYKKAYKMAWHFLAQCSMQKITHGKHLTKT
FT                   PALGLLWDLEGNEGKHDEEGTFAELLRYGTVHFRQTREGIRVVDVERPKETMRKGVLEP
FT                   "
FT   CDS_pept        join(177238..177954,178074..178319)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669754"
FT                   /orf_name="Pc17g00720"
FT                   /product="Pc17g00720 protein"
FT                   /protein_id="CAP79359.1"
FT                   /db_xref="UniParc:UPI0001831455"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ4"
FT                   /transl_table=1
FT                   /translation="MPTSSSQSMAYQGYTRRLGHGIGVYPVRAHLPPPSSVLFSIVVEL
FT                   CSLTQKADDNGPSLHGGYLCSVLISGSREYARSTSLVDLNQPDPLSMHVQFLDLAPQGP
FT                   LHVRFTTLKSSSRSSVVQGEICSAQSTAPRKTYTLAICTMGNLNDKAGISLELPGHVLP
FT                   SRETDCARLTDAFAFFTSPPTSACRVYTPRGGPTPLWSPTIGQQKRDQWAKLDNGENFR
FT                   LEELGLLADIVRITHPRFNVPSVSLTFDFVQDPAGQKEWILNRGTMNRLQNGRFDMDLL
FT                   MIDEEGKLIAAIKHQSLMFERKRHLGRQRGKKKDGEARL"
FT   CDS_pept        join(178373..178403,178474..178868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940139"
FT                   /orf_name="Pc17g00730"
FT                   /product="Putative uncharacterized protein Pc17g00730 "
FT                   /protein_id="CAP79360.1"
FT                   /db_xref="UniParc:UPI0001831456"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ5"
FT                   /transl_table=1
FT                   /translation="MVSSATLQRSYNKSLSYLEKFPQITGLSETSHLRLYILGFLQCLA
FT                   VALNQETCHATSCRRSLLTVEGQALTVEEVENPGWFGFTRGRSTFVGGHCCVDSGRDPH
FT                   KRVRPKKDFDCDGYVILSATCRPIAGLKGRFRHEKNA"
FT   CDS_pept        join(179209..179464,179506..179797,179860..179963,
FT                   180016..180134,180183..181255,181309..181381,
FT                   181429..181849,181901..182050)
FT                   /pseudo
FT                   /gene_family="HOG000076490" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(184986..184998),complement(182668..184934))
FT                   /pseudo
FT                   /gene_family="HOG000076622" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(185598..185738,185783..185996,186081..187267)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126767"
FT                   /orf_name="Pc17g00760"
FT                   /product="Putative uncharacterized protein Pc17g00760 "
FT                   /protein_id="CAP79363.1"
FT                   /db_xref="UniParc:UPI0001831457"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ6"
FT                   /transl_table=1
FT                   /translation="MSASSALLCADILVSFCLELGERSLPVYLKLFPDQAHIYRRYTSS
FT                   PGFAQSFSIHLAAFASLDQSTREKVLDNAPAILSCEIKEHCSTKLIGSFATPNPNPGDM
FT                   GAMNECNKYKSFSTDPCLVSSPLDYFPYDMDFTPWLQSDQEASEPMEIDDQQSQPIEDV
FT                   HDETPNAALIFDTSDISLNANTLPPTESENAPCVDLSRLKSSEGQERISGLKTMIEESL
FT                   EQMHTKFVEDGGKETGIGKAFACIIDHRPELLEKDEKTRNFRKGSDPIAKFFRIICKRF
FT                   SLLSSVITSKVVEGPGGLNLLRICCEWVLLETLCYTSIGIAPHRRWLAVPAQELYSVSR
FT                   EGVEAFQPLAMNGAKPWKDLRKVDSAPLGSWTLYRGYIVHVDTGCSSCFAKVSDIRCLA
FT                   DGRYAVVYTWLYTREQVAEELEVDGALSPRSRAHLDRMWPHKDRYVHMLSTNRTITLWD
FT                   TAISRAPESVVSALCYSAIYSTTPTSRRIWNVDNSRFKWMKRILLLEAHEGKVVK"
FT   sig_peptide     185598..185660
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ6 "
FT   mat_peptide     join(185661..185738,185783..185996,186081..187264)
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ6 "
FT   CDS_pept        join(complement(188389..188566),complement(188074..188355),
FT                   complement(187398..188026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669755"
FT                   /orf_name="Pc17g00770"
FT                   /product="Putative uncharacterized protein Pc17g00770 "
FT                   /protein_id="CAP79364.1"
FT                   /db_xref="UniParc:UPI000183152E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ7"
FT                   /transl_table=1
FT                   /translation="MLKEILEEVGPNFAIGSIPDPSTLDSMSEKTRPLWLSSTSSIPQL
FT                   LDSSQSWRGRVPLVRARNHTATAVRSESHLCVNYQGELDTVADPNVAISQLVDADPNKP
FT                   VFLTGLRLPIIENLEFRVPLDVCKVAEPFYESNEQVNMTPKYSFVDLHIDYGTDGLATP
FT                   IGDCRKIWLLYPPTTHNLRSMKVVDGQRLRLARLVHELEGCVVVETTSAHAIHIPAASL
FT                   HATFTLQGGFLIAKDFTTSRSLTAFSELLATGLDESLLPEARAKCFEWLERCLEISLVH
FT                   QKIKESVSAWLRAEEKLASWAATQRGWRVSVRRIWDQVSLPDSATICECDKQVSETSFA
FT                   THFTSTHLSFLFSTCQLRHDRR"
FT   CDS_pept        complement(188982..189452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822509"
FT                   /orf_name="Pc17g00780"
FT                   /product="Putative uncharacterized protein Pc17g00780 "
FT                   /protein_id="CAP79365.1"
FT                   /db_xref="UniParc:UPI000183152F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ8"
FT                   /transl_table=1
FT                   /translation="MRINYLPPIPISQSSFNRPSIVLQSSFNRPSIVLQSSFNRPSIVL
FT                   QSSFNRPSIVLQSSFNRPSIVLQSSFNRPSIVLQSSFNRPSIVLQSSFNRPSIVLQSSF
FT                   NRPSIVLQSSFNRPSIVLQSSFNRPSIVLQSSPNHPPIIPQSSPNHPSTAYV"
FT   CDS_pept        189596..189967
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975714"
FT                   /orf_name="Pc17g00790"
FT                   /product="Putative uncharacterized protein Pc17g00790 "
FT                   /protein_id="CAP79366.1"
FT                   /db_xref="UniParc:UPI0001831530"
FT                   /db_xref="UniProtKB/TrEMBL:B6HAZ9"
FT                   /transl_table=1
FT                   /translation="MLGKGFVDFFPVKLSSMLHWKFRALRPSPTWYAFFTGMVSFLDTD
FT                   ARELLQFAIEMCAMQKKQVNTRGQRQFESASFYQAIQSNGRTLNKPVAVFTEFTVMGAD
FT                   PSFMITCLLATRPSTVVTT"
FT   CDS_pept        join(191051..191187,191230..191453,191513..191718)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126768"
FT                   /orf_name="Pc17g00800"
FT                   /product="Pc17g00800 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP79367.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001831531"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB00"
FT                   /transl_table=1
FT                   /translation="MSNTKVEYMDAMRSIPPGSTWTGSRKEGFTAEVGNQNLSASPRSA
FT                   LLRTQSVDTFYFHAADRLVPFDETLKKLDSLRQTGKFRRLGLSNFSAYEIAEIVVLCHT
FT                   RGWIRPSIHQGVYNAISRNLETEIIPACRRYGLDVVVYNPLAGNLLTGRYTYSGSEDNA
FT                   GRYSTKVFLGPIYRPLYFEDNFEAL"
FT   CDS_pept        join(complement(192816..193183),complement(192147..192714))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126769"
FT                   /orf_name="Pc17g00810"
FT                   /product="Pc17g00810 protein"
FT                   /function="acyl-[acyl-carrier-protein]-UDP-N-
FT                   acetylglucosamine O-acyltransferase activity"
FT                   /biological_process="lipid biosynthetic process "
FT                   /protein_id="CAP79368.1"
FT                   /db_xref="GO:0008610"
FT                   /db_xref="GO:0008780"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI0001831532"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB01"
FT                   /transl_table=1
FT                   /translation="MPVVRTVTTTSRHFCFRAWVTCFVIDVLADCASITLVMRQWWGFY
FT                   FSHLNDISYSIFLIPTMTPNFFDFGVRLGQLTRSAFIHPTAVVSAGATLAPDVKIGPYC
FT                   LVGPQEPYTQGFISIHMLLLSIGNSCTIRENVTIHTGTLGGGGLTLVGNNCLLMARSHV
FT                   GHDCQIGNGVVMANHVLLGGHVTVGDFANIGGGTAVQQFVRLGHFCRIGGLTALRKDVI
FT                   PYGLGVGSPATIVSMNIKDMRRRGLEKVAIIDAARFARVITALSTEQTLEQVISRLHPD
FT                   NGHSRIMQEISIFRAQLSHKGICALSPSRF"
FT   mat_peptide     join(complement(192816..193096),complement(192150..192714))
FT                   /db_xref="UniProtKB/TrEMBL:B6HB01 "
FT   sig_peptide     complement(193097..193183)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB01 "
FT   CDS_pept        join(complement(194943..195216),complement(194523..194920))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940140"
FT                   /orf_name="Pc17g00820"
FT                   /product="Putative uncharacterized protein Pc17g00820 "
FT                   /function="nucleic acid binding"
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAP79369.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR008906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001831533"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB02"
FT                   /transl_table=1
FT                   /translation="MAREFQKEGRAPEASFLSFCGLLSGSLDFPSVLLLNPSPLDHLPP
FT                   DEMIEGSQTLSWIRDVLRPMQPTLRTSLSWICSRWQPMFSWIQYISWVLNISPCAYWKD
FT                   HQREWPVLTRLARDLLSIPATGAGTERLLTVAQNICRTRGGSLDESTMRDLVMYAYSEG
FT                   SESGKQSISWVEHDMASDDEWEEFEVEAERHEPISDDEWDSAEMSVDERSGTTKTARQR
FT                   Q"
FT   mat_peptide     join(complement(194943..195132),complement(194526..194920))
FT                   /db_xref="UniProtKB/TrEMBL:B6HB02 "
FT   sig_peptide     complement(195133..195216)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB02 "
FT   CDS_pept        join(196706..196734,196888..197164,197380..197397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18126770"
FT                   /orf_name="Pc17g00830"
FT                   /product="Pc17g00830 protein"
FT                   /protein_id="CAP79370.1"
FT                   /db_xref="UniParc:UPI0001831534"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB03"
FT                   /transl_table=1
FT                   /translation="MKNPPNVTVTYEKIQYYQVREIVSVDVSVDVSVDVSVDVSVDVSV
FT                   DVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVSVDVN
FT                   PSM"
FT   CDS_pept        join(complement(198218..198386),complement(197965..198107))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975715"
FT                   /orf_name="Pc17g00840"
FT                   /product="Putative uncharacterized protein Pc17g00840 "
FT                   /protein_id="CAP79371.1"
FT                   /db_xref="UniParc:UPI0001831535"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB04"
FT                   /transl_table=1
FT                   /translation="MVDCINLDTTSKKAIAVTSIRDWLKYDPSLPRHSRSQPGILDCLL
FT                   VQISQQHGCLCAYRMANFTQAIRSAPHHMLLHVGLGRIASWAYCLVIVEPVDLLSLSD"
FT   CDS_pept        join(198883..198996,199103..199163,199222..199298,
FT                   199419..199506,199580..199664,199748..199814,1
FT                   99921..200004)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076701" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669756"
FT                   /orf_name="Pc17g00850"
FT                   /product="Putative uncharacterized protein Pc17g00850 "
FT                   /protein_id="CAP79372.1"
FT                   /db_xref="UniParc:UPI0001831536"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB05"
FT                   /transl_table=1
FT                   /translation="MVFVDSASAWIGNACIRTNRVHHNTFDSPHDAASYMPEDFASPSP
FT                   CRRTCANSLIVYGVLERHQMSSEDNEDHASDTSSLRHLKGERGRGARYESSGDSSSIVV
FT                   MWKGQRACDSCPPVVRSESASIDLGRAVVAYLFMGIPNHHPCHVAFKLIAIGCHLKSRA
FT                   GELHNSVKAVGTRAEDAMEHARRPATLV"
FT   CDS_pept        join(complement(201557..201652),complement(201413..201504),
FT                   complement(201247..201335),complement(201092..201149),
FT                   complement(200731..201015),complement(200097..200283))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975716"
FT                   /orf_name="Pc17g00860"
FT                   /product="Putative uncharacterized protein Pc17g00860 "
FT                   /protein_id="CAP79373.1"
FT                   /db_xref="UniParc:UPI0001831537"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB06"
FT                   /transl_table=1
FT                   /translation="MSPETSSARDGTGNGRPTELASSVRSSRPQPGGQLQTSSASRRRP
FT                   ASANTDQPPSHRLRQDPPFPWHVSPAQPAILTSVANIWAGVQDLMLKVQGASPPGLRGR
FT                   VAGKMKYSRNEGPLDALVRPIRVQSSDAETRHIHTGTESSAGRELATIRNSSPNDPSRS
FT                   QLRQRSVGPQGRSVERSVENGPRRSARLGAHLPRGPSTSAPPRRTLANSDAGYIDSGNQ
FT                   YVDPGKLKSISGSCISPGKYTLAPGAFTNLQENQDLLLGSCLYIPD"
FT   CDS_pept        join(201717..201855,201940..202041,202116..202186,
FT                   202234..202325,202756..202960)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940141"
FT                   /orf_name="Pc17g00870"
FT                   /product="Putative uncharacterized protein Pc17g00870 "
FT                   /protein_id="CAP79374.1"
FT                   /db_xref="UniParc:UPI0001831538"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB07"
FT                   /transl_table=1
FT                   /translation="MADLGVFNLDRVLAWLAFFRHAATGARTAIGADIYLTNKKRTPRQ
FT                   HALYAIAWAPYLHGSVAGMEHLLETVGTSKKAFTRATLVAVDCDDHALAKGLAIMGGNI
FT                   VVVCFNAYGARCESVSQGHVTVHGCLGFTTRFTESPHKTPSPDLRTNLRHSITPRRPSY
FT                   SPRNLMIPGVNKAVNRNVTFAPEVVGKGIESASGFRGAI"
FT   sig_peptide     201717..201791
FT                   /db_xref="UniProtKB/TrEMBL:B6HB07 "
FT   mat_peptide     join(201792..201855,201940..202041,202116..202186,
FT                   202234..202325,202756..202957)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB07 "
FT   CDS_pept        join(complement(204128..204650),complement(203669..204065),
FT                   complement(203273..203612))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940142"
FT                   /orf_name="Pc17g00880"
FT                   /product="Pc17g00880 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP79375.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001831539"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB08"
FT                   /transl_table=1
FT                   /translation="MPTPFNKMTDDENHQTIDKIVHNFVSQRDEKSLNPLRLANVSVSE
FT                   FSTELANHLSTINEGGSIALGRGETLASISLSKSLESLFSTSTPCVTDGPSLTWTKLVL
FT                   FAGPDFEGSTQLNIDNSSVELPEYDLKLLRSGRPWRFLSPWPDRDDCTKELQSSETALQ
FT                   ELSNARKVIGEVLAQISLVEQRLRNHHRLVSQLFASGDYAIHQGKNPTCDGAQPFVPTQ
FT                   GVFDPEPTAEDGSPSYQDSPTIPAPIHYASKAGSPGPVNEDSNDRTLSEDATVGNPTQR
FT                   GDSGHVDGKRPEFRLHTSDFIQNLSEILDDPNSWEVMRWSEDGKSVLIGEESIFPAHML
FT                   AKMSTKSYQSLIRRLYYYGFHKTGGAYHHDSFIRGQPSSIRPAREMSHSPSLPSPLHKR
FT                   TSQGGPRYKVIKRKRTRDSV"
FT   CDS_pept        join(206620..206722,206857..206962,207016..207204,
FT                   207495..207597,207644..207654,207742..207883)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940143"
FT                   /orf_name="Pc17g00890"
FT                   /product="Putative uncharacterized protein Pc17g00890 "
FT                   /protein_id="CAP79376.1"
FT                   /db_xref="UniParc:UPI000183153A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB09"
FT                   /transl_table=1
FT                   /translation="MRTDKLETAREITTRSTMQSMLGDQSTRFGLAGQNDAKELEPCFP
FT                   ANIHQRKNHGTLSRVFFCSLDLQNLATAHQSASEPASRQRSARSHGLHTISGPAASNHA
FT                   ACPMCSIAIQGRGPTTGCISSRRSLSTVGGPRRAPLPSCGRAGASSAASRSDSGECDEP
FT                   GYNMLLSCWINTADSDSTTGTHPQIPTTRMRSKPTSCLLELPYTSAINALSLPL"
FT   CDS_pept        join(208559..208757,208805..208852,208893..209061,
FT                   209275..209289,209429..209486)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822510"
FT                   /orf_name="Pc17g00900"
FT                   /product="Putative uncharacterized protein Pc17g00900 "
FT                   /protein_id="CAP79377.1"
FT                   /db_xref="UniParc:UPI000183153B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB10"
FT                   /transl_table=1
FT                   /translation="MSKAVESHYSSRSVKLSCILCPRSCQHITGFSSSRVHYPLSIDDV
FT                   SANPSRPDGIWHITVRATYREGPIGLSRIACTLFSTPTDVQGRMWIRAPLCEYHPVLSG
FT                   DRGECLYSISSGSKCLAGNQSDFNHAISAAEHAVLHFIISSDPERTIYCVIIADLLLN"
FT   CDS_pept        join(212429..212754,212817..212834,212888..212987,
FT                   213152..213225,213321..213443,213541..213559,2
FT                   13640..214095)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975717"
FT                   /orf_name="Pc17g00910"
FT                   /product="Putative uncharacterized protein Pc17g00910 "
FT                   /protein_id="CAP79378.1"
FT                   /db_xref="UniParc:UPI000183153C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB11"
FT                   /transl_table=1
FT                   /translation="MGGIRKASRPLRRPDFRSRLQRALSLSSLESEDTGSVSSSATGDT
FT                   TKDESPQEENNSGDQENSDAADESEQEATLQRRTVFGHETDLEIRGQTQLSGDSNTVAL
FT                   ECLTELDNRMGSIERSSHDQATWNETIRNDLVDILGRLAIVETEIVSPTESITMDTPIM
FT                   DAELEGHWKRLCTPKLSRPSRGASREPLYVKEYFKPFISSTIADGLYCLVQLVVTIEIR
FT                   TYYGKLWIEEREEITTVVRKRSGGFSIRPIATRPRIVLIGLSRCIPFPWTTININSTDQ
FT                   RAKVFPISEAYLSGVILNPPRLRLHKYQSNLLITFLICIKNNQGVESGEPAVNLRRTMY
FT                   RDACAYLYWSFLDQGAQRYSSEQEIGNTHTS"
FT   CDS_pept        join(complement(215540..215602),complement(215168..215226),
FT                   complement(214835..215033),complement(214611..214739),
FT                   complement(214230..214535))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669757"
FT                   /orf_name="Pc17g00920"
FT                   /product="Putative uncharacterized protein Pc17g00920 "
FT                   /protein_id="CAP79379.1"
FT                   /db_xref="UniParc:UPI000183153D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB12"
FT                   /transl_table=1
FT                   /translation="MPFPVTQVTACWGIQTYADRKEQERFHSDSSPALGSPRVSSQTAV
FT                   VKYSCVLRLPVIPFDLLGLDRKMIGTLSNRRLGCTSIRYPISTFHNIFWICLGQHCPGD
FT                   YLDVMSIVEEEIQKAQEEREEERDKHCQLLEQLEAEKADETSKLQLLESTNAALQDQVP
FT                   WNDIQLVLDQAHGDMVSTTTRFWNTIDTLQNRRLASYLPGSGVIHADWAEQSGPVTQGH
FT                   DAHLSISESNVPLPSQQEPYASNQFGSLV"
FT   CDS_pept        complement(217128..217517)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15940144"
FT                   /orf_name="Pc17g00930"
FT                   /product="Putative uncharacterized protein Pc17g00930 "
FT                   /protein_id="CAP79380.1"
FT                   /db_xref="UniParc:UPI000183153E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB13"
FT                   /transl_table=1
FT                   /translation="MLQYIRIIFQQRENPLTPRLLRFICPSFSVASTLAKIAVSLVGTF
FT                   LLKSAYLGSLYILLADYLCVVAWYWWLFQQSTAGRAKLRCISCHLSAMALLLLVIAVIG
FT                   TLERSWMIALEVIADSHVIPLYQQC"
FT   CDS_pept        complement(219320..220033)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975982"
FT                   /orf_name="Pc17g00940"
FT                   /product="Putative uncharacterized protein Pc17g00940 "
FT                   /protein_id="CAP79381.1"
FT                   /db_xref="UniParc:UPI000183153F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB14"
FT                   /transl_table=1
FT                   /translation="MDTLDYQNLRSCAIGAITGALGFSYFVIYLLMFLIFHFPSSQRSI
FT                   PYALAVMAFGGGSAIWYLCVVFQNCFSAFQKEKMTKEQDSVWFGGLFLVWTAALPTIAF
FT                   LFPAQPLLQLGCASAFTMIAVGSLSDGYLKDMDMGAFSAQLSLQFASVVLLALVPSIHA
FT                   LAEPLHAPYPLATAFGRLVLLNLCGYALYALRPLERIGMVQFWQPSLHGMYLILTYSLV
FT                   EYSKAVLQVAIPYMS"
FT   CDS_pept        join(220424..220748,220867..221087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822769"
FT                   /orf_name="Pc17g00950"
FT                   /product="Putative uncharacterized protein Pc17g00950 "
FT                   /protein_id="CAP79382.1"
FT                   /db_xref="UniParc:UPI0001831540"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB15"
FT                   /transl_table=1
FT                   /translation="MEDIVPIVRQIGQQQAHNAYYRDCYSPFKLLQELTELQRLYKSGT
FT                   ERSTNSVHQLLRNFQNTICNLVERACEAQAECEKFCSVNESHSARVVFEPIRRMYTNPQ
FT                   ASLQEPRENHNVLCVPQYFSPKAHTPCRSPPTQSSHESDTAIKKFRLPQNVHHKGEQCL
FT                   APPSATVLXYHFPHSQAE"
FT   CDS_pept        join(complement(221851..222074),complement(221323..221788))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669996"
FT                   /orf_name="Pc17g00960"
FT                   /product="Pc17g00960 protein"
FT                   /protein_id="CAP79383.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001831541"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB16"
FT                   /transl_table=1
FT                   /translation="MKLSTKSRLDSLVSTTALSFTVAVLVCLSLVFVGCSSSSSPKGLH
FT                   FLKVRYARKTSMLINAKQSSGRPERISKAANAVGGVASSSHTSANEAIHEATSAASSMV
FT                   EAQVHEFKSHLPQYYLVGLWSYCKAKDGSEMVCSDPSTSFTFDLSAVLDSTSINLSNIL
FT                   PDIDLSLVSGYRRFSQSVVCLYIAGFVVTTLSGVLACRKVFFSKGSRSLAIFYTVCDTW
FT                   TNIEETC"
FT   CDS_pept        join(222575..222992,223044..223167,223249..223390,
FT                   223451..224905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076485" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669997"
FT                   /orf_name="Pc17g00970"
FT                   /product="Pc17g00970 protein"
FT                   /protein_id="CAP79384.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI0001831542"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB17"
FT                   /transl_table=1
FT                   /translation="MPFSRQSEVEHWERKLYDYRESHFELSARVHISHLVFESGFRRRM
FT                   DGRQNIRRLTQMMKMQGCQRLMRDNHVPVIVPRAHWQDRVRPRSGGGIIPSLDMELDYR
FT                   LCAYDHENLITAARDFLGHDDQWWIVDVYLTDNEEVSPGDHRNEAESVRHKFIQSLKER
FT                   YPNDNRPPDGLIYERINRKKGMYLKQFFKHETLHQKLNSLLVIPGLWGGMRIGLLHKLT
FT                   AMHCDEPVACYWELIFTTFSRLVGGREELLLLIDGVTVELLQSRVPKISRKDLQSLQVE
FT                   LEEGRLFPNFSEEARQDIWARLKEIDYPIPTLKTFFKDRLYLEVAQSVMKRLFVQPRGD
FT                   KITIDQGVYGKYDTPVPVSMALRQEWLGSDLLEFWRFSFQYGFEMTDHQRLKWPTDADP
FT                   EDMLDRRSSGSSFLPKQEIWRHFFTLVRARGFQAPVTDDTSFATGELPSPRVCEFPEDL
FT                   AEEIEVAKRCGKPYSNTVEADRFALSAETLRQSQASVRVTAGFLRQSVFKAFFGYLWNS
FT                   NNQMAGGDPPDDNIEVHHRGERPTTANVGRAMMATDGMDVDPGSLRPNPLVTSAARTHN
FT                   AAATASPADILPPFGVMTITVGGTTRILDLPIHDSFMKDFSTGLFNNNFNVQTDEREKR
FT                   SISPYTCYSHYLHNPSSVLHAEFRQNEHTTYAIAPSQIGSGSKRRMLDEDEQMARAEIW
FT                   LQEQIAWLSDPRNGEEDL"
FT   CDS_pept        join(complement(225996..226209),complement(225562..225946),
FT                   complement(225453..225507),complement(225213..225278))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975983"
FT                   /orf_name="Pc17g00980"
FT                   /product="Putative uncharacterized protein Pc17g00980 "
FT                   /protein_id="CAP79385.1"
FT                   /db_xref="UniParc:UPI0001831543"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB18"
FT                   /transl_table=1
FT                   /translation="MFRSLLTVIAILGQVQALDLRPLIQSTCNTVSSWHQAMGGSLNAT
FT                   LSTSGHTQSVSLSPDCEAEMESALSRCVDGASIDYRGIAVSLGGQLPLMASVRQHAERA
FT                   AGYEVPSQQQGNCSCQSPPLNKETTRPESTQQQTSTNTESTGSATHTASSSCELPNISS
FT                   FASISASPSAPSETHGPTTIPSPKGSGELDLNTCLIKEADHREGGLCHCASGSAKLKPL
FT                   RFLGLWNLLYNVSGCKI"
FT   mat_peptide     join(complement(225996..226158),complement(225562..225946),
FT                   complement(225453..225507),complement(225216..225278))
FT                   /db_xref="UniProtKB/TrEMBL:B6HB18 "
FT   sig_peptide     complement(226159..226209)
FT                   /db_xref="UniProtKB/TrEMBL:B6HB18 "
FT   gap             226533..226632
FT                   /estimated_length="unknown"
FT   CDS_pept        <226879..227094
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127020"
FT                   /orf_name="Pc17g00990"
FT                   /product="Pc17g00990 protein"
FT                   /protein_id="CAP79386.1"
FT                   /db_xref="UniParc:UPI0001831544"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB19"
FT                   /transl_table=1
FT                   /translation="SQQQTPACVYSHGIAYMDATTENIDHLSKVSETSCNVDAGNCHRL
FT                   SYANLSGIFLCNYVSTPNFKPNRAPC"
FT   CDS_pept        join(complement(230490..230548),complement(229493..230214),
FT                   complement(229050..229195),complement(228758..228994),
FT                   complement(227885..228718))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941190"
FT                   /orf_name="Pc17g01000"
FT                   /product="Putative uncharacterized protein Pc17g01000 "
FT                   /protein_id="CAP79387.1"
FT                   /db_xref="UniParc:UPI0001831545"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB20"
FT                   /transl_table=1
FT                   /translation="MHIQSVKKLAMESIAIAQQSSPVSAPGDEPTTEPKHNGAITEKDS
FT                   ITGAIRGSYTSTGSDDHSLFPIENSKNNTTDLLQNVTTRATFLPFAFNRTSQVWASLET
FT                   PHSEDSSGPFVESLYHSTSQIHTEASEIRETGQSRVFQSDGASGTEWSGTAGRITGTAG
FT                   HHLSLAHSDKSQTLSRTLTGTVASSQTNSSISGPTSATKTSDHEWHDTAIYGSNLSARL
FT                   SKQGTLLILSSVFGGSVALIGVFIIHCFILRYLKRHAVGLNSGEGGEGGEGGEGGEGGE
FT                   GGEGGEGGEGGEGGEGGEGGEGGEGGKVHSRALNMYATTPSNSESTWYGHGHSHNEASP
FT                   SPASNSASCQHNPYPVDADSDTNGLASKTDNGDRGRIMVYWQTRSAVPSRAVSPGKLPY
FT                   VMLDFSFNTPTAQVGAYSIPTGQVMTSGHQLISQNPGKALGTKVSPDGRDQISDQCCIS
FT                   CMILLVLLFSNTSPTHRITAVENEVERSVGTLMATIPTIHRPSLDPTTVLSHLLAQLQS
FT                   KQALQRKRDDYKIIFPAKQSRVPLVNLLGAGQILTKIETLKRRGWPKLKPLSRAVYRNS
FT                   KRISRLRAHLSFLQAELEELTSRNGSSKAVVCKQEMTKNELSPRRICLIGSLLVQHYLE
FT                   KCSEGPVDGNRVNIPGLTALLIDRFPSLRA"
FT   CDS_pept        join(230938..231126,231179..231349)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669998"
FT                   /orf_name="Pc17g01010"
FT                   /product="Pc17g01010 protein"
FT                   /protein_id="CAP79388.1"
FT                   /db_xref="UniParc:UPI0001831625"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB21"
FT                   /transl_table=1
FT                   /translation="MAPPLSRVKREQLRKRRNNLLRRHNEFWLLYGMKSWLIMELPDGQ
FT                   IFTYHSHPDTPPPSREDMKTRSKPTIVRTPRDYISATSAQSVGRDIPVFCAPVRQDQKW
FT                   EALANHLNNNRRMVS"
FT   CDS_pept        join(232765..232796,232845..233481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941191"
FT                   /orf_name="Pc17g01020"
FT                   /product="Pc17g01020 protein"
FT                   /protein_id="CAP79389.1"
FT                   /db_xref="UniParc:UPI0001831626"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB22"
FT                   /transl_table=1
FT                   /translation="MVPKDLLHEGMGDGKHNLTTRIFGSLLSLLRSTPDPASQQRQPET
FT                   HAFCFLQRWLQSESLAAGWTCPEGLELHKFFGLLEVHQGKVKDECFQLTWSTLTGWRRV
FT                   ISSIRHAAVHRIPHDRKTFLKMVRAAIKFSKCIAGFKGSKRLCRIQKFVKTSVSGFDQL
FT                   RAQLKHNARLQISLGEAHRDHLARRLVLLPEAVRRVLQSIEDGFVSKVKQFLHAEFKST
FT                   "
FT   CDS_pept        complement(233738..234346)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234786" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20669999"
FT                   /orf_name="Pc17g01030"
FT                   /product="Pc17g01030 protein"
FT                   /protein_id="CAP79390.1"
FT                   /db_xref="UniParc:UPI0001831627"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB23"
FT                   /transl_table=1
FT                   /translation="MYVGFREPRRGQSMTDMNPFQHRTPGYSRDNTSSIYSRSTDTAKD
FT                   AIPITTIPTTLQIKPSLPEINLLDHQISMASGSTMALETTRPRLRKSKTQPEMSMSELK
FT                   TERIQQHRQQGLENDFYCKCFESFHQLVSTTMDATQSLALQYHFNRANSPSGDPRLIRA
FT                   IVSLRVALDKSRAEETSAEQEWKQQWKVSPVRQSSLRWL"
FT   CDS_pept        join(complement(235940..>236313),c
FT                   omplement(234882..235794))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127021"
FT                   /orf_name="Pc17g01040"
FT                   /product="Pc17g01040 protein"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP79391.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001831628"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB24"
FT                   /transl_table=1
FT                   /translation="QSSVTQCFDAFPHLARNIFCHSSKTPIPRCIRWFASAFNLTTDGF
FT                   YNSEGLSKILKAAVNPSRRMFDVATANPAGCRIAIVASRTSDGKACVLANYRGTSPRST
FT                   NTAYEFLTPHNDRQDPSLLDAYFQPKELPGLCLQDGGVRANNPLAIALRESSIIWPMAK
FT                   RHDLLLSVGTGFSTSPPSRPTGILGRIWEGPLPRLFRAMMCSPSMDGKQGFLEALNYLP
FT                   HLSTPDIFRLDQAIDGTLPGLDDVCSLEAMSDMDFAVPAELVRTILASAMFFFELDETP
FT                   IQGKASFHCRGSVLCSRPNPAEILQRVLVEFPGARFKSGQDLDLGSIDLVDICRFCGYF
FT                   RKRVDFRVTSLDEMVTIEIANDTFRERIGGFPKSAQEFLDEQKVYAQFGRADHRDQEWP
FT                   PQRSCYCYRGSKRLVHFLEPALGQKRRRL"
FT   gap             236314..236413
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(237020..238010),c
FT                   omplement(<236429..236961))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941192"
FT                   /orf_name="Pc17g01050"
FT                   /product="Pc17g01050 protein"
FT                   /function="zinc ion binding"
FT                   /biological_process="metabolic process"
FT                   /protein_id="CAP79392.1"
FT                   /db_xref="GO:0008152"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0001831629"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB25"
FT                   /transl_table=1
FT                   /translation="MALWLDLVKENEAWDLVDTNRLEQLVQELPNPKHQYPCLLYFYGN
FT                   SNRKKALRTLFPYNNITRKGPAGLIRLHLSTKTAHTQNPILFAESGLCLEQSLGDSKWL
FT                   KNPTTKHQTFSLGGADGTLTPARLQQEVKRQLVLPWTQILCLFLDSVPDIQAATNLLQR
FT                   PRRQLTIGDEVVPAPLQVVIALTNSQHVTEAFAQECAQLQKLDTGTVTILDLRPRHGLS
FT                   DSVVFQPLQTLIVKQLSIVQAERISNCRRFSASHMSAFWSTGVQRHERLLHAAPFDLLA
FT                   RARRDYVRNKSMDDCLREVTQTSIGYSKEDFDDLVASAFLMDAYPPQMHGFSPTVVFAA
FT                   LYEKRCLSIWDNEFKYHIAGVSSRFVHHFAQLSAVKTSAAIRKETLCRLYRQWGGLRST
FT                   TTCLVCLSRPPEHMLPCKHAICDTCVVIFGKPSRLGEYHFEISQCPICEERSDVTVRQL
FT                   PPTKPPVILSLDGGGVRGLIQLGLLRVFRKSHWHSDRIFAGPVHWNQCRY"
FT   CDS_pept        join(238459..238937,239003..239234)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941193"
FT                   /orf_name="Pc22g26690"
FT                   /product="Pc17g01060 protein"
FT                   /protein_id="CAP79393.1"
FT                   /db_xref="UniParc:UPI000183162A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB26"
FT                   /transl_table=1
FT                   /translation="MAFGVDDHTSTPAKTGSEKTPLREIDPVLVLSCSAADVAPALCRV
FT                   NQMHHADETSYVRMLREEAEMDMRFSITVGAANWALLAGYLVIPGTFTSLQTSNQVEKT
FT                   LQANEAGRTVLHMIQNPPLLAIACLLFVSGIAALMRLMHFPNLRGNYPWLINKVFVPLC
FT                   LHAAAGLLTTVINVCTSQGGDWSVMAIITTAVTGATLLSCSALLALYKFYKLERIRKED
FT                   EDIRRSRASTTLDT"
FT   CDS_pept        join(241125..241643,241694..241793,241845..242074)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941194"
FT                   /orf_name="Pc17g01070"
FT                   /product="Pc17g01070 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP79394.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183162B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB27"
FT                   /transl_table=1
FT                   /translation="MNRAKIKHSRPSTVWLDESAFCNEQLSPNSTASPHIQPPTIQKMA
FT                   TAVITPGSMEPHPGRPNARITQLNQNPWDTFEPAAGSSQDRSLIFARNKSERGKLVHIQ
FT                   QLEKQFSPATGFLELMEQVAHPSFLKLLECYHHDASCTLVWEPTEVSVSHILASSCSIT
FT                   TDELVGIVKPVLEGIQYLRGLGRALATLGPETILLTQSGDVKTMGVENSCEIKESEMNP
FT                   ATMKLCALADVVTKLMLKNRTYEWEMEIQNLPCQLESISVEEILQVSSFRLIMFSANVT
FT                   E"
FT   CDS_pept        complement(242775..243038)
FT                   /pseudo
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT   CDS_pept        243366..244070
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941195"
FT                   /orf_name="Pc17g01090"
FT                   /product="Pc17g01090 protein"
FT                   /protein_id="CAP79396.1"
FT                   /db_xref="UniParc:UPI000183162C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB28"
FT                   /transl_table=1
FT                   /translation="MFLDPLPADTKPSILFRAECSSNTSFREGYLCARKREKRPPSRKD
FT                   FGDHLSWNRKPTRFLSFGTWRRAMQQRKILEDEGRVDIVVIAVWVEGLAGVYSAEEAAS
FT                   RLEYIDTGLGPRKSPHHEEYLVEGGIAADEYRILAVFEGGGLENDAVFEYPSYRIQATI
FT                   PSLCFLGRRSSYALEDIGNEIYSHSGVRDDMKRDVLVEAITGNQLFFPTLRYKYPGQSE
FT                   NLAHHRTKSITN"
FT   CDS_pept        join(complement(247376..247479),complement(246938..247330),
FT                   complement(246373..246898),complement(245791..245924),
FT                   complement(245608..245696),complement(245516..245562),
FT                   complement(245294..245323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20670000"
FT                   /orf_name="Pc17g01100"
FT                   /product="Putative uncharacterized protein Pc17g01100 "
FT                   /protein_id="CAP79397.1"
FT                   /db_xref="UniParc:UPI000183162D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB29"
FT                   /transl_table=1
FT                   /translation="MKDANSYCIEEVIGSQATKGKECEIRHLIMKTLQLAPSMYPMMTL
FT                   RNNEQTMKMLRRSLLLRVLLNTRILVPSTTKRCLHGLEGLFVADVPAETLVVADVPAET
FT                   LVVADVPAETLGFADVPAETLGFADVPAETLVFADVPAETLVVADVPARRFVDAGPRLR
FT                   RTCGLLRVSLVITASPCGVHLVTQRPPARIVVHADLSCEAPFYTRGARGSEGAQVLHHW
FT                   ARGSDSRGHGDSQARRQERDTMTQRSVRTEVLIFFGLGIGLLLYFFGYVSTKEPVAQLV
FT                   ARVTVSLISVEAIATTLKGCLETLWPTEPSLDLAYFLSKLCVECGEPLSSTVEKKATPA
FT                   KAHELGSRDRHPLARLQRYYYTDETLETKSTRPANQTPRVNSDRRRSRHDPQAQSWPLS
FT                   GSDGTGGCCLGGTAGAGYNPIRGCVLGRSHEKNYANYGQTT"
FT   CDS_pept        join(complement(251053..251171),complement(250962..251007),
FT                   complement(250817..250913),complement(250610..250701),
FT                   complement(250546..250575),complement(250171..250506))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941196"
FT                   /orf_name="Pc17g01110"
FT                   /product="Putative uncharacterized protein Pc17g01110 "
FT                   /protein_id="CAP79398.1"
FT                   /db_xref="UniParc:UPI000183162E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB30"
FT                   /transl_table=1
FT                   /translation="MNQQAIRCLWKILFSANPLYSQPIKETRLGLAGPNVYAKIPACIP
FT                   KARARISTPQRRSRTEDNRPQCTSARTAALVVSSSLVFANRTSYYTPDLVPSLHTTQHT
FT                   LGKVYNSKERANNRKLETSILPVELFVQYFALHNTNTLADIHAIVDRSSPSPPVKHTCE
FT                   ETFYPGSEIRPTTRALSRLPPSTSPPSHHDGGVGCSPSVSRGLIPLRLYNFLSQVGSSR
FT                   AFGAQKLPGASGAASSK"
FT   CDS_pept        join(252266..252382,252429..252836)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941197"
FT                   /orf_name="Pc17g01120"
FT                   /product="Putative uncharacterized protein Pc17g01120 "
FT                   /protein_id="CAP79399.1"
FT                   /db_xref="UniParc:UPI000183162F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB31"
FT                   /transl_table=1
FT                   /translation="MDAANSSPDQEKGEQQPDELPSLSDKDNNQETSDNVPPMPSPSQH
FT                   EEETRHTLATEPFQPILNVLADLERDDPKFAFPAARLVGLYRRLWESCVSKHIDGQKLE
FT                   QSNQILKEAGASLRKERDGLQLYHKKKLARLRFFEQALESSRERLISLLDDWNYPYNAN
FT                   LAGLTDIAREE"
FT   CDS_pept        join(complement(254452..254589),complement(254045..254398))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127022"
FT                   /orf_name="Pc17g01130"
FT                   /product="Putative uncharacterized protein Pc17g01130 "
FT                   /protein_id="CAP79400.1"
FT                   /db_xref="UniParc:UPI0001831630"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB32"
FT                   /transl_table=1
FT                   /translation="MDHPTSPSPIDRPAKRQCRVSHAPEDEPKLENQPQQVTNGSTIEP
FT                   KIPVRTRGTLTGEFMKVVSLNDSLATPVLKLLDLYFCLWQCYVVKSAEKIRLEEEQRQL
FT                   QASNDLLASDSDVLLQLWNVQASVLRERKRAVQALCNGLVSALEASDLQAYSVDEPEPW
FT                   "
FT   CDS_pept        join(complement(256697..256699),complement(255286..256644))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941198"
FT                   /orf_name="Pc17g01140"
FT                   /product="Pc17g01140 protein"
FT                   /protein_id="CAP79401.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831631"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB33"
FT                   /transl_table=1
FT                   /translation="MPNIRDLPNELLLWIVSHLDGSALFALAKSCKDLDFRLQPSTWKY
FT                   NIRFQNSNLLHLAVKYDNVGLADALLQHNANINAFYRGKTPLMRALKYSSAAVRELLLS
FT                   QRDLDINIQNQARDSALSYAIHYGSSSIVKSVLEHRAASVDIKHKYGRTALHLAVFAGR
FT                   IGFVQLLLLSGSDPNLEDDSGQSAWSWACRINRPVMKIMFINGPDCEVYLGARNAQDSE
FT                   LPLHEAVLHGSIDAVKWRLRQKDLNLDIQDRKGYTPLHLAVQSRRLEVVDLILGHPLAN
FT                   VNCKDKDGNTPLWLSTYSSCDEITERLLAEKDIDVNFVGGRGRLEAPSTSLHHAATRLD
FT                   TILLRRLLAVPGIALSLCVAGHSPISVAAYHGHVKTIACLLSMEGVEINGRGLIDPPIC
FT                   RAVSHGHLDVVRLLVQQGARLNVNVAQSQPMTLLSALLPVAVTWIWSGKYYAMA"
FT   CDS_pept        join(257439..258211,258264..258579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941199"
FT                   /orf_name="Pc17g01150"
FT                   /product="Putative uncharacterized protein Pc17g01150 "
FT                   /protein_id="CAP79402.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831632"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB34"
FT                   /transl_table=1
FT                   /translation="MPWNPFAVCGIPHGGPASCCGVTKKGQPCKNSVKFQDTKIGHERL
FT                   TTLAREPFDLSALQSKLCDIARAFLCARWHRQQQADQVGQRWYEAAIRNQARVPHGSRV
FT                   AAPSIAHPGQRQMSSVSRSRPAPGNTDRSPHGLRQDPPVPLSTNPEPVQPFNPFVTSTM
FT                   LRTNSVPWHVSLAQPAILTSVANVWAGVQSLTLKDLTLSDEFDDIHCVFCLAEDDDLAN
FT                   ESVILRCQCKALSHLACAEEWLEKRTTGFGTSCCVCRNEGPLDALVRPLRVQSSDAETR
FT                   HIHTATESSPERELATIRNPSQNDPSRSQLRQRSVGPQGRSVEQSVDNGPRRSARLGAH
FT                   LPRGPSTSAPPRRSARLNSTRR"
FT   CDS_pept        join(259203..259236,259477..259514,259663..260229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941200"
FT                   /orf_name="Pc17g01160"
FT                   /product="Pc17g01160 protein"
FT                   /protein_id="CAP79403.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831633"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB35"
FT                   /transl_table=1
FT                   /translation="MNRHDYARSLTGTDTTEIPSNLTHLVHGPKTPFLRFSVLALLKPL
FT                   NTMPPQTTTIIDGEFERLKSIQMNALDKNVMAFLEATHKSVQAKGIYNPRGPFERSLIH
FT                   YAAMGDCTELLLQLLETEAPIEDRDQNKRTPLSWAAEYGSYNVTKILVQNGAQVNSLDD
FT                   TYTSPLTWLKYAGHPDCKSLPATKRFLKSNGATTRGFKRAWILQKLGRL"
FT   CDS_pept        join(complement(262635..263291),complement(261847..262533))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941201"
FT                   /orf_name="Pc17g01170"
FT                   /product="Pc17g01170 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP79404.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831634"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB36"
FT                   /transl_table=1
FT                   /translation="MTSRLLPSTSRNEGVTGSIDQTKADIATLRQQYTKLILWEEKCIW
FT                   FDKKQPQSKIHIPFHRWQALLAIHKHLLQEHEHFFSMSQMPSARAAIRDVPYDYAMFNR
FT                   MWRYGIYSPLELLHQNLPGSLGPMLHFIYHVSSTLNRFLEFDPALGVILYEQLGDVTRY
FT                   HMAAQRQHRKHLAGISRYWYRKAADQNPNLGRIQHSLAVLSHFYALQRLFYLTKAFKYG
FT                   APELEPVVRLDGNPLLPGVPSHGIAPIWLGEASERITLSETRILLTDFGEAFSPSKERK
FT                   YESRTPLVIRPPEARFEANDPLSFSSDIWTLACTIWSIIAQRPLFEGFLATEDDMTCEH
FT                   VDTLGVLPLEWWRRWDARRLKFTEDGKPMNRNPFRSWDDRFKDSVQQPRRESDIPPFDA
FT                   REREAFFDMLRPMLSFRPENRPTTKQILDSEWMLKWALPEYGNIQDNV"
FT   CDS_pept        265229..265744
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941202"
FT                   /orf_name="Pc17g01180"
FT                   /product="Putative uncharacterized protein Pc17g01180 "
FT                   /protein_id="CAP79405.1"
FT                   /db_xref="UniParc:UPI0001831635"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB37"
FT                   /transl_table=1
FT                   /translation="MPPATAETLLADLSPQLDMFIRFLKADLTSTILQGDLERGGTRRA
FT                   TEPLATGKNTQCWIQRLQEVHQWTNLALWERDWLQRTGRNEPTPCSGSHRFGTMAPFIQ
FT                   EEGLPDNHNTKKALQHGRRLMRFEREFGHGITLLLLPVLSAFRSLSIGEEARTMEMLRS
FT                   SDFAYVTR"
FT   CDS_pept        join(complement(268491..269351),complement(267200..268439))
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(271606..271731),complement(270966..271544))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941203"
FT                   /orf_name="Pc17g01200"
FT                   /product="Pc17g01200 protein"
FT                   /protein_id="CAP79407.1"
FT                   /db_xref="UniParc:UPI0001831636"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB38"
FT                   /transl_table=1
FT                   /translation="MLLFSRDDCIPCVASHFLVYELNYPSTHKMEAYLSAAITYLMPWN
FT                   ILHIRPRDDQDDQLLEIGATGWKLEISLDEMKSSISGCAFLLDHGGYFWCIIRHTLQHW
FT                   RNPEWRPLSGADGLRVGSKTQKGTLHLXPVFYGNTSALVXFSMLEMTTPGRIMIWLAEN
FT                   QXTRYTLQLKAKLLLQIIKAGLIGNWKLFRRLVLDFAICGQRVMLXVIVITMXLVNTMX
FT                   ERSFANXFEPLE"
FT   gap             272336..272435
FT                   /estimated_length="unknown"
FT   CDS_pept        join(272772..272909,272992..273638,273707..274511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941204"
FT                   /orf_name="Pc17g01210"
FT                   /product="Putative uncharacterized protein Pc17g01210 "
FT                   /protein_id="CAP79408.1"
FT                   /db_xref="UniParc:UPI0001831637"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB39"
FT                   /transl_table=1
FT                   /translation="MGITESKQVAQAIYVACTEAEKRGSNSIEPVLTDNVSTPLVYLLL
FT                   RFEPRNENAQRQIAPHHENAQIQIAPHHENAQRQITPRQENAQIQIAPQHENTITASPS
FT                   MTARRKSVDNRHEGKRLPKKQKNNDSGGGLLLYVLKNASVWKRNPLSFFNERGSKLDLE
FT                   SSPLDGMSDYMTTLGNRMGIDQVRQRLLKVMHFRLSKWHVWNESTQDGRKRKRGQWALE
FT                   GKKFDNVCRTLGCATTSESQDXYFHLGNLFYSLLGINDTFVFRKIPIDADPESPHLKEL
FT                   RQCRLVTRXSQKVIDELADSIFNAIWESCNRVSYALPPPISQSPRPFDQNLDDQASRPS
FT                   DSFPVSTTEPPLPFNPGFAQGFXQNFLDFSDQNLNIVGLNQPLAETFVPGHAQGFYWAP
FT                   FPDXNTNIDDLDLLHRLFEEHHRSDPERGXQDHTQSCNQAFRLTPLEVASGSSGCESRQ
FT                   SNFTAESEGQAYAGPLLANDVSYSPDLEEYRIHRAAKHPQETTQGPDNLTXGQIXGVSP
FT                   IQVTPESGIAAC"
FT   CDS_pept        join(complement(274906..275094),complement(274625..274795))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941205"
FT                   /orf_name="Pc17g01220"
FT                   /product="Putative uncharacterized protein Pc17g01220 "
FT                   /protein_id="CAP79409.1"
FT                   /db_xref="UniParc:UPI0001831638"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB40"
FT                   /transl_table=1
FT                   /translation="MSQGAPSCISLSSDKVKACATQAWPEVQRYAQGLPKPKISALAPF
FT                   FPTDACAAPINAAVSELTSYVGRKLTLVIPLFMEGETSIAGLAIDMDHFYQVSGKCDVE
FT                   VSQAAKLVALIVDIE"
FT   CDS_pept        <275470..>276081
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18127023"
FT                   /orf_name="Pc17g01230"
FT                   /product="Pc17g01230 protein"
FT                   /protein_id="CAP79410.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0001831639"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB41"
FT                   /transl_table=1
FT                   /translation="MAAIQQLSESTYTFLSIIDHTLDDIESLCRLDNGHDRRVPCYGLG
FT                   SLEIVPLEVLQMIILRLDIQSITHFRRVNRRAGLVVDQVPQYKQIIVHAPASIRGCLSI
FT                   RTGFSFSCQDLYDKLRTTNCDSCGDFGGYLYLVTCRRVCFLCFTEKTDYLPLLRSDVIR
FT                   KFGLRPKYLAKLPSFKSVPGRYSSRGIQCRRRITLIDHSAA"
FT   gap             276214..276313
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<277742..>277975)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941206"
FT                   /orf_name="Pc17g01240"
FT                   /product="Pc17g01240 protein"
FT                   /protein_id="CAP79411.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000183171C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB42"
FT                   /transl_table=1
FT                   /translation="DLQDARRFASRNAVIANEAPPQIYXSGLLFAPKGSIIRKVFARXP
FT                   PTWISEVSGVEENXSADVQSFDDFSGRGFPISFSRDSRTLAYGANNSSIKLRAVMTGVL
FT                   RQSLERHPQDIEGVSLVSFSPNGQLLASIAFDRTIKLWDPAEDRQARDLQTSRLKVREL
FT                   TFSPCSRFLASHSGNTIQLWDVDTETDSLRLRHTLDGHLDHLWGPLSFSPNGQLLATSS
FT                   SDHMLTFRNTRTGSLWLPLGYQPSCFMIHGSVLVLGYGSGRVLFITSVLSGIVNEVRWE
FT                   SLMPCCFFAC"
FT   gap             278118..278217
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(279616..>279755),
FT                   complement(279000..279531),complement(<278606..278945))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15941207"
FT                   /orf_name="Pc17g01250"
FT                   /product="Pc17g01250 protein"
FT                   /protein_id="CAP79412.1"
FT                   /db_xref="UniParc:UPI000183171D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB43"
FT                   /transl_table=1
FT                   /translation="YADASHGDWNDAKSTEGAVWFFGGAPIHWYARKQSIMAPSSTAAX
FT                   WCALDRPARDAQWHTKIATILNLPSAGKPIVIITDNINTQLLMGNRSCKNSTRXLDMRW
FT                   LFIKDAIFQNKIDLQRVDTNNNVADGFIKPLEKEAHERFIHILGLN"
FT   CDS_pept        join(complement(284052..284061),complement(283156..283729),
FT                   complement(282788..283103))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822770"
FT                   /orf_name="Pc17g01260"
FT                   /product="Putative uncharacterized protein Pc17g01260 "
FT                   /protein_id="CAP79413.1"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000183171E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB44"
FT                   /transl_table=1
FT                   /translation="MTRFFLCARWHRQRQADQVGQRWYEAAIRNQARVPHGSRVAAPSI
FT                   AHPGQRQMSSVSRKRLTGSGNTDWSPHALRQDPPVPLSTNPEPVQPFNPFVTSAMLRTN
FT                   SVPWHVSPAQPAILTSVANIWAGVQDLTLKDLTLSDQVDDIHCVFCLAEDEDLANESVI
FT                   LRCQCKALSHLACAEEWLEKRTTGFGTSCCVCRNEGPLDALIRPLRVQSSDAETRHIHT
FT                   ATESSPERELATIRDPSPNNPSRSQPRLRSVGPQGRSVEQSVENGPRRSARLGGHLPRG
FT                   PSTSAPPRRSARLNSTRR"
FT   CDS_pept        join(complement(288589..288619),complement(288012..288460))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19822771"
FT                   /orf_name="Pc17g01270"
FT                   /product="Putative uncharacterized protein Pc17g01270 "
FT                   /protein_id="CAP79414.1"
FT                   /db_xref="UniParc:UPI000183171F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB45"
FT                   /transl_table=1
FT                   /translation="MWNLLIMSFHYLERDDPKVAFPAARLVGFYRRLWESCVPKHIDVR
FT                   KIDQSNEILKEAGTHLRKERDGLQLHHDKQLARLRFFEQALESSRERLISLLDDWNYPL
FT                   RPNLTGLRDVAKRRVRIYLFRVALSYLGDIEILQPAKQCRENCRIESSYILSDSL"
FT   CDS_pept        <289648..>289681
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975984"
FT                   /product="Complete genome, contig Pc00c17 "
FT                   /protein_id="CAP79415.1"
FT                   /db_xref="UniParc:UPI0001831720"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB46"
FT                   /transl_table=1
FT                   /translation="SINTSSAPGQF"
FT   CDS_pept        complement(<289851..>290290)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18975985"
FT                   /orf_name="Pc17g01280"
FT                   /product="Putative uncharacterized protein Pc17g01280 "
FT                   /protein_id="CAP79416.1"
FT                   /db_xref="UniParc:UPI0001831721"
FT                   /db_xref="UniProtKB/TrEMBL:B6HB47"
FT                   /transl_table=1
FT                   /translation="MALYSSNGLPYPRGHSRAMSMVHCHALACRSVSYSVTYMFRWSKL
FT                   GRKRRQRVVVLALVRCGRMSSVLLESHRLQDQWNSRQVRIRFTYLRRGYSRFCLGNTHR
FT                   GCTVDQLSRLGRRDIRHLRIDVWTSQPKSCLFDRLAGCKVDLV"
XX
SQ   Sequence 292067 BP; 75779 A; 70253 C; 71330 G; 73925 T; 780 other;
     gctaggtacg gcagattggt agatggagca tggttcagac ggtggtagtt tcaaacgctc        60
     ttcaagcgaa caaatatagt aggtccagaa tagcccctcg actacactca atttgcgacc       120
     tgctacagta ttataatcag ttcttactta tatgacccat cggtattgtc aatttatttg       180
     cattcgtttg cattcgttta tcgcctattt aactagggtc tatgtaacac aaggagtgcg       240
     ttgcttctgt tgggattgga gacataatca tacccgctgg gcaaaatact atcattatct       300
     cgcagatgtg ctccccgctg gaactacaat actgaaacta gatttgtaat caacaaagag       360
     aggtgaatat tattagactg gaattttcca cttcacagac gatctggatt gagctagatg       420
     ggtctgaacg ctcccgtcta tatttctctg cgatgcagga ccccattgct tatcaggata       480
     tttatacaag tttagctacc ctggcagccg cacgaacaag gcatcgagtt ggcattttca       540
     gtggtggaat tagcctcgcc ggtgtcggct gtatcggtga tgggaattgg gccaaatgta       600
     ggatttccgg tgcataccgg ttcgccttct tgcggtcgat atttgctgtc gccattatat       660
     tcaacaatac ttccaggcca agggaagtga atgtctacat tttctctggt aatgcagcca       720
     ttcacgttgg cgatgaacat aggaggaaaa gccagcgatt gtttgggtgt gttgtccgac       780
     gaatttgacg gcgactcatt agccaccgtg atgggtgcgc agttcatgta catctctcga       840
     ttgccgatac gattaaacca tgtccaggcc aaggtgtatt tcccgggtgc aataccgtca       900
     gggatcgcga agtggagttg gagagaatgg tccgactcgg cactcccatc aagatttccg       960
     ggtccttttg cagggcatcc cccttcgtag gacttgatga ctttccattc cgaattcttt      1020
     gtcggctcgc gatcactggt gaggctcacc tggcaggacc caccgccatg ggtggcactg      1080
     cccagaagct tgatggaatt attgctccca gtccgataag tcgcctcttc agtcggaacg      1140
     ataaagtcac ctggggatat cttgcaagga aagtcactac catctgctgc aagtggcgag      1200
     ttgtcaagtg tcttcctact agatccgtag ggctcgggag acgccattct caggtgcgca      1260
     tatgtcggcg aaaatgcaac tgcctgcaaa agcagacacc atttcacgag tatcatggta      1320
     aaacgcgaga tggcctcctg tggccgaaca aagttagcta tcatgtagct gaaggttata      1380
     ctaggattgg cagcggctta tatatctccg aagtgcacat gaatggaagg acgcttgagc      1440
     tgttgaagct gccgctgata tgtgagtcca tcacaagagc acagtgcggt ctagtcctgc      1500
     tgtccttcgg ctaaaagtgc gccacagcag atagcatgtc gatatttggc tttcgagacc      1560
     aatgtgattg taccgattga gtggaacaag tggtgagccc atcattgcaa taaaatgttc      1620
     tcacatccga aaggaaaatg gagttccccg tttaagtgag tcgggtcgac tcaccactcc      1680
     ttgtacgatc tggcacgaat tcaacgatgg acttaaccaa ccaacatccc ctatgaagac      1740
     caatgctgct aacattctgt ccctgtgttg aatttcccct gtcacaaaag tgcggcgctc      1800
     gccacggacc accatttatg tctcaagtca ctacgaacaa actcgaatcc tagaattgtc      1860
     cgctcaattc ctccttgatt ttatcctcct acttcttgtc cgctctcggt cagagccagc      1920
     gaagaatctc aatatggatg ttcaaccaaa acttaaaacc aaaccagccg acgcagcgaa      1980
     tcaaaaagca cgcaggagaa gaaagtccct tttcaaaaag gcctccgaat atagctcgga      2040
     atgcgatgcc gatatccacc tcgttcttcg gatgaagaaa tccgggaaga tcttcgttct      2100
     ggtctcaaac acaaaagatt ggcctctttc ccaacatcaa ttagtaagtt ctctgcatca      2160
     tcgatctcgt cttcagaaag gtactaaatt gatttctaga agtcctatca tcctacaccc      2220
     attcaaatgt ctctaagcga cccagagtcc aagccgtgaa tctcttccat gctagcaaca      2280
     agtgtcaccc tcgattgggt acccttgtag ggttatcctg attgttcagc caagcccctt      2340
     gcagcttatg tccctcacaa agtcattccc ccctatcact tatgtgtagg attaacctcc      2400
     gagggcttcc gtcgtgtcct atgaattata acatctgcgc tgcgccccga agattggtca      2460
     gagtcgatca accttattat tcatgtccat tacaaatgct gcggaaatgt attacaaact      2520
     tagttgatca cgttaaagga tacgaagatc cactcacact gaagggacta acgatgaatt      2580
     catcgtccga aatgtaaatt ttttaggaat cagaggtaaa taaaactcca tcacagttca      2640
     agatttgcac tcgcctagtc agataataat tgccttgctt tacgctaaac ctaccctcag      2700
     cttccatgat tgttccaagt acgaatttca atgcagggcc tggttgctca atcaggttta      2760
     cctccagtgg cctgaaaccg aaaggcatct tggcaaacat cgttggacaa cgaatttgcg      2820
     tgcagatagt acgagacttg tttgataata tatcccttgt atactccatc actgacctgt      2880
     acatgtattt cccattctat cccatcctgc gagtggccta tcgcgccgac cgacattgac      2940
     cacattcgct taacaagcta agaacagcat cctcttaggc acgatatcaa tcacaccgtc      3000
     taaaaagatt tggaatcaag cgcctcagta aggatgtcgc cacctactaa ccagcaaggt      3060
     tgtacggaat tatgcctgtc tgggataaag gcacaagatc cccgcaccgc tgttgatgag      3120
     ccgaaataaa cgagcagtac tccctcgtgg aatgctcaga cgtcgaactt tggcgagaat      3180
     tgcgacaggc tcaattctag cgcaggcagg gtttctgagg agccacccgg aagggtgttt      3240
     gagtggcctt ctgatagcgt tgccgaagaa taaacgtctc caggggacat catattctcg      3300
     cacgacgtct cgcgtagtgc ttcatcgtat ccatagatgc ttggccgcaa cgaacgtggc      3360
     atattggttt gggcagctcc agattgcgag ctcacatccg gtgcgataac tggtcgtgaa      3420
     gaggccatgc caaaaatatt cttatcgttt gatcgacggc tgtcctcggg tccacgctgg      3480
     cagatgcagg ggttcgtact tgtcagcaac cggagacggt tgagcacaga gaattccaac      3540
     ttcagcttga cgctgtacac caccgtcttg aagctcactt gaatgtagtg tagcttgtac      3600
     tccgcgagga gtagtaagac gttcaggatt acaacgagga tgttgatgca aaatagatgg      3660
     ataatggcgt tgtggccgtc gcgaccgcgg attgtaatgg cactcttgaa atgatgcacc      3720
     gctttatata tatatatgcc acagatgacg aaatcttgta tgcaaaaaac cgtcgattgg      3780
     atgcggtcaa atatcgcggc agggcgagca aagtgtgcat cgccgcggtt gaggccaaag      3840
     aaaaaaacgg tcattggaat atgtagtatg caggcgtttg taatgatcat ccatagaacc      3900
     caccgcacct ttctcatgtc ggagaaaacg aggtgcagac gcgagtagag gacgacagct      3960
     tggccggtaa ccatggcgta ccatcctatc atgaagggga tggacgtcgg gaggttggac      4020
     gcctgagaaa taaagcgagc catagcagga atggcatgca cgagaattcc ccaggatgca      4080
     aattgcatgc tccagaaata gaggccccgg tagcgcttga atgagtcgaa cgtgacaatc      4140
     cctgtttcta gggcattgta cgcgccgata gagaacatgg acacgatctg gatgatggag      4200
     atgttcccca tgaggatggc cccaacattt ggtggcaggc tggtcatgag tgtatccata      4260
     gtctaataag gcttaacgta tagaggataa acgatccgca gcttggttta taaaagcctc      4320
     tcgaaccgaa aactgccccc gcaatgagat catgacatcg tagctagggg ctccttggaa      4380
     gctctaaaaa cgtctggact attatcggct tgggggaata tgcttggttg gattcccagt      4440
     ggtctgaatg ggtctaacgg gaagctatgt cgaaaccagt gtaatgggta gttgggactg      4500
     aggcatataa ttgattttca acccatgcca cagttatttt tgacgtgaag gaaagctttc      4560
     ccactattct cgagtcatag ggctagtttc acgacgactg caaaaccgag ggcgggatca      4620
     tgggcccatg actgatcgcc tcatcttgaa tcttgacaaa tgattttcga ggaaccatgg      4680
     aaacactgcc tcgggagagg atgaaattat ccatggatac ttaggattta tcgatctcat      4740
     tggaaacctt accaataaag ttctgctcca cctgctttct agatcagtca tggttgaggt      4800
     tgtaccaaca gttataggag aatgcagaag aatcaggtat gctcactacg ggcgtagtct      4860
     tttggaatat tatgaaatag cactactgta ttcaaaatat tctcgatctc cagagtctga      4920
     ggactggtag aatgagccgg atgctggaaa aggagtggga ccttgccatt tccgtgagcc      4980
     aatcggtttc taggcttttc aggcaaaacc caaaaaaata tgcttatata atcccagctg      5040
     atccgttcaa atccgttgaa tgtttataaa ctgtctgcta gggttataag actggcgatc      5100
     gaatctgagc acatagaaag cgcagatttc gcattcgaag tgggtatact cattagggaa      5160
     gctagtacag aagaagttac ataccttctt gaacatcctt caaagcacga gactaacgag      5220
     aatcaacagg tcggcactcg acgaggacca agttattttc ttgtgagagc aggtaggaga      5280
     acccaaccac ggattgcttt cagcgtacca ttcttttgct gggcacctgc gtgatattcc      5340
     aaatacctca actgccgtac ctgtgagggt ggtcccttca gcaggaccaa gcaacaaagg      5400
     tatgttgcat cattactggc ctgtcgagac taggcttgtg gatcgtgtct ggactttttt      5460
     gaaaaacttt gctatttctt ctctcgacta caaatagaac ctgcttgatc tattgtcccg      5520
     tgggtcatcg acgagttttc tatcacagga ccgtaccagc gtcggtccat attcacacgc      5580
     ggtgtttgat tggtcctaca agtgcttcct ttgtccaggg tcttatcaga gtgtgaaagt      5640
     agcgttacaa tcttgcgggg taaaatggcg atcgtcgagg accccagcta atgagccttg      5700
     atagctgaaa tgcctcaaat ggttgccctg gaaactaagc ccaggttcct gttatggctt      5760
     tttcgacacg atctagaagt ctcatagtca gttatggaac catggtgagc tttgaggaat      5820
     gtagcacgag tggcaacggt tggtccaact tggatcccaa atcctagttc cataaaacaa      5880
     agccctatac atgtccttag ttgatttctg gattgttttc ttctccgaat gaaatggatg      5940
     tctttatggc ccaactttcg gaaactgttg taatagtggg accgtgtaaa tagtggaagt      6000
     tacatctagg acaatagtac aactacacca cacatggctg aggccagaga gcccttcttg      6060
     tttccaagag cggctcggat ggttcggctc tggncgatac tgaggcacaa ccgtatacct      6120
     caacatagat cccggtgcgc ggcggtcgat cactttctcc acaataaaac cgcagatctt      6180
     gtgcttttgc gctagcgcac cgtggggccc ctgtgtgtca atgggtactt gnctttcagg      6240
     ctcatgatgc tgatgccgac acagctgctt ggcagggggg aggtcacgcg ttcaccttgt      6300
     ttcagggctt ttgattgtct ccccctaaac tttnaaagtc gagactcccc gaaggccact      6360
     gcgatcaatc atttcttcgc tttgcccagt gtctttctaa acctgcaatc actcaccaga      6420
     cggaaggatt cagcatggca aaggaccaaa agccctcccg gcgcggtgca gaccgcggta      6480
     ttgccacaac gaagctcggt actggcaggt catgtgcctc ttcgccatgt tctgctcggt      6540
     cgactgtctc taggtccaag gcggtaggca agctgcacaa agggctggta ggtcaatctc      6600
     tgtttcccat ttcctcgctc gagccttgtt gtaaccttgt gctttatctc atcagtacct      6660
     taatgagcca tcttgctgac gttagctttt agggacattc tatagcgaaa cgcgcccgaa      6720
     agaaaaatga tgaagcaacc catcaaaagt gtttagctat gatggacgag gtacaagagg      6780
     agtgccagtt agcccttgaa gagatagaca aagagagagc ccatgactcc cagtcgatgc      6840
     agcgtctgca tgctgaaaag gcccaggaga catcgaaact gcaggaggct atcacagcaa      6900
     aaggcaaagc cttagctgag aaccagaggc ttgaaagaga gctctgtcaa ttgcagcagg      6960
     cgaaggagtn atcgcacgcc acaatgcagg gcctggtctc atggcacgat attcagcctg      7020
     tcttgcatca aacacatggc gagctggtat cggcgactac tcggttctgg aatacgatcg      7080
     acgcccttca gaaccgtagg ttggcatctt acttgcctag ctccggaggg atccatggaa      7140
     attggcccga gcaggatggg ccgcttggca ctctaggtca caatgcccta cccgggtttt      7200
     ccgcttcgag tgattatccg cttgtaactc aagaggcgcc agttccaatc aaccaatatt      7260
     aatcacttgt gtgaaacatg gcaaattcag cgtttccggc ggtcctggct ttactatgga      7320
     ggaaccggct agtcggttta tatagccact acgcaggtag atagctcatg agattatctt      7380
     cagtaacgcc acagccattc catcacaaca gtaaaaatga aaaataaaat ggttgttgtc      7440
     cgatgttctg ccgtggaaag aatattgacg taaatccttt gacgattaga ctcgctccgc      7500
     caagcgcagc ttggaaggca gagagaatgt tccatggtcg ctgaatgtgg ttagcggcag      7560
     ggcccacagc ccggggagat gatgcgctga tccgtcggaa gcaaccgaat ctgaccgatc      7620
     atgaccgtgg tccccaccca gtatttgata ggcaatatga ctcggcgaca ttcatgaaga      7680
     aatttggctg tttccttggc gcttggttca catatgcttt tcttgccact tggcagataa      7740
     taggatttca aacgacagcc tacgacgctg gcacgaacta cngtattttt ctggtccgcc      7800
     cacagtggcc gaaactcaat tgagcgggct anccgcgggt catnagattt ggaatactct      7860
     accaagcgta cgacagccaa tctatatctc aaattgatcc accactgaat gtggacgtga      7920
     gggtccagtg ggccagggag agggtagtcg ataaaatgat acccaggcgc tcgagaaacc      7980
     ttaatggcat gaatcagttt acaactgtca ctggcgaggc cagagaattc gtcccaagga      8040
     attcagtttg ttacaccgga attatagtaa atatttgtct actttccgca gccttacggt      8100
     tagttacagc ttccagtctg ccccagtgag atatgattgg tcgcgaagca caatgcgatg      8160
     gtgatacctc agctaacaag gctgacaaca ggctctggga tatattctac aaccacatca      8220
     tgtttcaatc cagatcactg ctgcgaccga agggttcgcc tagttgcatt atcctctgta      8280
     gtactgttct tcccctcttt ggccatcatc tccatagctg tctccacgac cgccaaccga      8340
     ctgcggatgt cctccaagtc actgcgaata gttgcaatcc agctgttaga gttatccaat      8400
     gctttttgca tgagcctggg aaaagtcagc ctttgttcgt tctctgatgt gtcgcataac      8460
     taacttcgtt cggatatcta ggctgattgt tataagcaga cgcatcacaa aacattatta      8520
     taggggggca aattcgcact cactctgcgg cacattgtaa ggcgatcata ctgcactgca      8580
     gtcctccgcg agattagcct gtccgggttg ttccagttct tcttctggtc tcgggcccat      8640
     aatctaggtg tgtggaggac tttcctggtc atcacccgct gcgatgccgt tgcagtggtt      8700
     gccaaaggag ccattctccg ggaaaggaga ctcgtcctcc gttgtatcac cggccgcgga      8760
     ccttggcgga ctccagacat cctcggaccc ggaggatgac agggacagtg cacgttgtaa      8820
     tcggctccga aagctttgtt gttgatcagt gaacggaatt tttcgaattc tccccatagt      8880
     tggatctgtg gtgagatact gagttctccc agccagatgt tgcaggacaa gtcgcacagg      8940
     ttgatatgaa gagatcattc tccaaaccgg aacttgtgaa ttggggggtg ggggggagtg      9000
     ctaggccact atgttacatc cgtacttaca gcaatcttcg cttaatttga caaccaatca      9060
     gtcatgagtt ccattaaact ttagggaaat gaactttgta ggaaggcaag ctttgcctct      9120
     aaagtctgtt tgaggttaca ttatttagta cccggtgggg cttggtctga gaatttcagt      9180
     gctttgttca ttttgacgta cagtaattac attcaagaac aatttccagg aatacgaaat      9240
     tgacagttag gcgttcttat agctagggat tgtttcaact ctaatggttt gagggagcct      9300
     ggaacacgga atcaataatt cacaatccag actcaccgaa ccgactctcc agaatggtcc      9360
     atgggtaatg ttattgaacc tttagaaagt ttgcagtgaa ccaagggtac ttagcttttt      9420
     actgggacct ggagaggatt taggctcact ttttccttct atcaggagca caagtcgtgc      9480
     tattgtccga aaagggctat tctggttact attagttcat acgagatgtc ccctcgaagc      9540
     gaggtggcct gggaagcatg ggagaaaaag cacctctccc ctggctggac gctcatcggg      9600
     cactgccgtg gaaatcccgc tcccatggat attatgaaca atatcaggtg gaccgaagcg      9660
     tcgagtctgc gagggaaaaa gtaccatatt ctgcgcaagc aacgtcgcac tggttccgga      9720
     tcgcctaagc atgcggccca tcgaaaccga gcaggagctt gtcgctcggt cggccataag      9780
     gcttcattag cgaatctcac aagcagaagg cctgcgcaaa gtaatattga gaaatgtttc      9840
     caaacaatcc taaggactga gcccagccat atcgacagca ttgagtcagc aaagacgaag      9900
     gattcgagac caggtatcaa ctaatatcca tccacctttt actacaagct aatcgtgcat      9960
     cacaggccgc gcgatgccat tactccgccc ttcacggcgt gaagaaacac gatcttcgtc     10020
     gcagatttga gactatgtac attgtgtctg tgtagccagg aagctgagat accgatgagc     10080
     ggaacatcca tactaccggc agttcgtcgg tatctgtgct acatcgcgat ctcgaagcag     10140
     caataacaaa acaactacct cgatgaatta gtgttgttgg atgtacctac gaacagagaa     10200
     tatggcagcc aggtaatcaa gctgcttgat tattttacgt acgaatttac atattggcaa     10260
     aatataaata agcaccattc cttggaatta tgacaatagc gagggagtac caaggttata     10320
     gtttgacaaa agttagttcc ccagagatca tgcacattac cgggatcgtc gatcgatcgc     10380
     cgaaccccgg aaaataacgt tcgataagcc atggaaatgc tcgctcggtg agaggatgcg     10440
     ggaggatgcg gctgtcacga gtgatcctca tggaaagctt atctaccagc ttctgctaca     10500
     cttgctttga aggttgctaa cccaaaagaa aagagatccg gagcaggatc aacaaaattt     10560
     cagtctgctc atatataggg tattgggaaa gggcaatatt ttattagaag atactctaca     10620
     ttcagcgtca ttaccgagac gcgcagggtg cttgggatac agtttaggtg ccgcaggtgg     10680
     gccggcccac agcacccact ctcgggagcc aatcggttct tctggtttag ttcaaaaacc     10740
     ggggataatt tacgtaagct catgtgatcc actggcatta tttctacaag ccatctgcta     10800
     gagttaccag actggcgata gaattgggca tatggagagg aattgtctgg ctcgaagaga     10860
     gtatacccag tataattatc aggggaaatc ttggtgcagg agaagatacg tagcttctag     10920
     aacgttctac acaccagatt gacaaagttc agcctgccac ttgaaagggt taatttctct     10980
     tcactgcgac caagtgaaca caaccacgga tcgggttgta gcctaccatt ctgtcgccaa     11040
     agtctgcgtg ttattccaaa tactcacctg ccccagcagt acctaggcaa caatcccccg     11100
     ttccatcgta cactgatggc cgaaaacttt gggcttgtgg atcgtgtctg gacccttgca     11160
     aatccttcga atttctccgg gccacaacta gaacctcctt gatctactgt cccgtgggtc     11220
     gttgctggga tctgcatcgc ggaaccgtac ctgcgtcttg tctaaattca cgcgcggtgt     11280
     ttgattggtc cgcccggtct tatttgtgtc caggttctcg tcagtgtgtg atagtagcgt     11340
     tgcaatcttg cgagggggtg gcgatcacga aaacctagct cgtgagccat gggagctgaa     11400
     ataactcact tcattgtcct ggaacctaga ctctggtttc tattctaggc tttccaacaa     11460
     ggtctcgact tttgattctc tgtcaaagga aaacagccaa tactctggat ttggaagtat     11520
     gttcataata tctgtaccga caggtagcag aagtattagt agaggcaaca tcagttggtt     11580
     gcgagcaaca cagaaagtac cgttagcgcg aggctcggca aaggggattg tagagggatc     11640
     aatgggaggc acgtcttatg gccaaccacg ggtacacaaa gtctccaacc cattattgcg     11700
     gcatctgttg aagcacttca accctcatga aacagacggt gaccgtggct agtgaccatg     11760
     gtcaaaacgg gcagagtagt cagtctgcca cagcgttgag cgatttaatt gcaaattcaa     11820
     tgatatgtga gaatcatatc cttgcggtat cagtcttttc agcagtcgaa aaagtggttc     11880
     accatactga acgcaggttt ttgaaaggaa taaatccagg tcgagacttg actctgaagt     11940
     agcttgtgat ccaatagctt cctcgctaca atagaaattg gcatctttca ttcagatgta     12000
     ggcaaacaga gattagtgtt gtcttgcaat gcttgttgcg ttgaaccgtt agtgtgagtg     12060
     ttgatgtgag tgttgatgtg agtgttgatg tgagtgttga tgtgagtgtt gatgtgtgtg     12120
     gtggtcaata ctcggccggt gaaggagacg gtcaccgtct agaccttgcc atcggtccat     12180
     gccaccctca gattatgtaa cttccctgaa tagggggttc tacttcaact tgttaggttt     12240
     atcggttatt tacgtccgtc actgtcacct atcaccataa ccactactat agtaggtaat     12300
     cgatcctaat aacggtgtat cctgttatat aatttattag atatattgct tttattataa     12360
     atttattggt gggactacta gacagtatga ggtgagtgga tttgtaggtt caacatattt     12420
     tgtggtcata tgtatatata tatttggaga cgtccagcaa actaatgcaa gcgaaagctt     12480
     tacactaggt gaaagctgct ttagtataga ctgttgctgc tcttagacac aaccccccgt     12540
     aggcgagacc gcattgtttt cgcagacgga atctgaggtt gtattgggac aagtctagca     12600
     tatgcgataa cgtcacgaaa ttcgcaatgc tcgatgaacc ggaagggcag gtgtggaagg     12660
     gagagcagtt tcaatagttt acgttcccat acttcttgcg taaaggctgc cgcggtagct     12720
     ggtgcggttt gtgccttcaa ataaagagaa taagtggaaa tcccttaaaa aaaaccccca     12780
     aaatcctagt ttaaacatac cgcatttgca agtaaaccct tgatattggt cttttggcta     12840
     gtaaattgac agcaactcgt ccaactaaat gccgatgaag tgcagtcgtt ccatatcgtc     12900
     cattcgctgg atcgtctaaa aagtttatgg cattgacggc attttgcact cggttttcca     12960
     gcctttgcat tagcaacttg atcgaagtgc tgccagcaag ctgctgtacg attgctggtg     13020
     gttgttaaga tgtaaagtgt gcatcacttg cctacatagt taaagaatat atatttctcg     13080
     acgccgataa gttacgacag tacactagat atctataata atgaaccacc acaatatctt     13140
     aagatataac atttgtgtaa ttataccatt acctactatg gttaatcagg atacaagtga     13200
     gtttcttcgg atttctgagc gcatgtatga aaatacctcg taaaccaatg ttgaaacgaa     13260
     aacactgttt gataacggta atctatgagg ctgattcagc aggattatac agctaaatta     13320
     aagaacggtc gcaaagtttt atgtaagtga ggggcggatg agggnnnnnn nnnnnnnnnn     13380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     13440
     nnnnnnnnnn nnnnnnnnnn nnnntgtcga ggcctagcta tgacgtggtc tttgtgttct     13500
     agttcagaga tatattcatt gattgctata tctcagaggg aaacacgagg ctatatatac     13560
     aacaataggc aaggttgatt tccaatcaac ttggtcgtcc gtataggcat tcggactgaa     13620
     ttccgacgat gcggcttagt tcctgatctg caccagcctc atatcacaac gatagatctt     13680
     ctctcgcccg ttgaccttag tgctttcacc actataggtc ttatacaacg tgtcagtcta     13740
     tttctgttta ttctactggt agcgtagagt gcattgttga agatgcatgt tttgtcattt     13800
     cctgaataac cgttacgttt tatcgtttat taacatcatg cctctcttca aacagtgtct     13860
     ttgcaccatc tttttgccca gtaaatcacc ttatattttt cctgcctaca cttattgccc     13920
     gcgctttagg tttgtatccc taatatcgat tatatctatt ttagtgagat aggactcttc     13980
     taaatgatgg tgatatggat cacatgacgt ttcaacttgg cacgtgatta gggactatgc     14040
     gttgggcgct gaccggcaag cgacagcaca aaatattccc tgcgatggtt ccatcgccct     14100
     cagtaagtgg aaagaagcga tacatttgga gaaaaattgc ttatggtaat aatattgttg     14160
     taggctcact actaagctca gatggccata ggtgtaaaag gagacttccc aagcccacca     14220
     atcattggga ccgtaatcgc tgtgatcaac acaatggagg ctttttggaa cagatgcttt     14280
     caaattttct gcaaccgggt ggcttccaaa ctgcttcctc tattgcttgt cttggtcatt     14340
     tgagctagca cttggctcag ggcggctgaa aaaagattga atactctcat ccgccatcct     14400
     gccaagcgcc tggtatgagt tattacccga ttttatgcgc ttggcagata tgagatcttc     14460
     gagggtggtg acaatagctt gccggctgtt atcacctgtg ctgacgtcct caaaatagtg     14520
     ggttcgcggc cgatttgcat cttcttccgc ctgtttgcag aacgccaata gtgcctcggt     14580
     tccgtttaat tcttccctaa aagtttgttc ctcagatgtc gtctcgttat ccaggctggg     14640
     caaataacgt ctttgtccgc gcatattttg accaactcca tgcaaatgtt gaagcagtcg     14700
     taatttccag ctcgtaactt ccttatgcgc agaattaagg ccttccgcat tgatcaacca     14760
     tgacagatta ggagccacgg acgaagacat gtaatcaaaa gacccggagg atcgttccac     14820
     gtcacccaac agactaggtc gcgactggtt tataagagta agaaactgct cacaaatatc     14880
     caagctcttt tgtgtgctgt tcttttcatc ctccatcatc tggagttcgg ctgtatcaac     14940
     gccagaaata acggggcctt gagcgcatgc ggtctgtaga cgtgttcgaa tatcgcgtaa     15000
     gtgactttca agatcgcatt tcgtattctc gatgagttct ttatactgct ccagaacaac     15060
     tctcgtggtc tttgtcgtgc gccttataag aagatgttag gcccatcaaa ggataaacaa     15120
     cagggactta caagttagca tatgcaagcg cgattgaaat agttgatttg taccccgcca     15180
     acatgttttt gaaaccagaa atgtcttctc ccatgtatct caacttgagc cagtctcttc     15240
     tactgctgtg atcttcagtt gaatgtgtgg tacaccccct gatcaaagta ttgaattcct     15300
     cacaggcgct tttgcacctc atgagaggct gttcgagcga agcaagctcg acatcaaggt     15360
     tatcgatcga ctcctccagc gccagaagaa ctccctgaag agcttccaat tcatggcgaa     15420
     gctcacgaac ctccttatcg cgcgattgaa gactctggac ggtttggtag agcactatcg     15480
     aagactggag ggccagtgcc acaaatgttg tgatagcaga cgcggtaccg accacttctg     15540
     ccatgacgga ttgtcgcgaa gcttggttct gaactttgta atgggaagtt gaaaattagc     15600
     acagcttgtt gctttccagt gacacgaaga gagcacggac atttataggg aggtggatga     15660
     ttgtgaggga aggttggctg gtgaggggta gtggcaattc tgaaacagaa cctttccata     15720
     tttagatagc gcgcggctaa aagcattgat cacatctgac gcactcaaat cacacgataa     15780
     acccgaaaat ttggtctaaa attaccaaaa aagcatgaca tcaagacata gccaagacat     15840
     gaaaagaaat ttgcaacata agagcaagat aggcgcgcgc tactccccaa cgtaatttgt     15900
     ttcctacgca ccaacggatg ccaccgggcg caaaactgtg cgtaatctcc tttattcgat     15960
     ggaggatcag ggtattaggg actttatgtt ccaaagctct cagcaacaat gtattgacta     16020
     catacatggc ttccattaac tacggtactg tggagaaata ctgcttatgg aaaactctct     16080
     ttggaatccc aatctgaatt attatgctat ctgttgtttc cagtgattgg tcgagtacgg     16140
     cggcagcagc agttgggcag agctctggaa acacgtatgg aggctgggcc agaaacagag     16200
     ccgtcctttt ccaagaagac acacgcccgc attacctccc cgccacatcg ctgtttgatc     16260
     agccgccgct ccacacgacc gctttggaac cttcacctat cacagcaaca atcgcgagat     16320
     aaacctgacg cttacggctt tgcgtcgatt ggatggttta ctcttcttga attgtaaaag     16380
     tcccctccag gccccgtagg agcccacaaa atacaggatg gatcgaaatt agtttcacca     16440
     ctttgttatc gtagactcgt tctcgaaacc tattccgaaa cacgctaatc catttcggat     16500
     taggcgcgac gtcaggtatt gaatggtggt gaaatataca gtcacgtgac aagatcgcct     16560
     cgaaatatct gtaacggttc ctgccaagaa tactgacatc tcgcagcctg ggccggaatg     16620
     ttgccaaact agactgcagt aggatatcga gagccaacag cccaccgtat atagattaca     16680
     gagagaatca gagtcagatc ggatcctgtt tttcccttgc tcactagtat aaaataacat     16740
     catcaaataa tcgtatatta tttctagtca tgatgctctc acccaaagtt gtagccaata     16800
     accatatcat atcccgggtg cgatattgcc actatgcagt tggaatccca gcgttgccat     16860
     ccggaacaat agttggatta acatggagag tcatgtgcta gagcaatgtg ttagaatgtc     16920
     cactactttg ggtaacaaga tatagaactg acatcggtca aactcgatag agaatcaaaa     16980
     aattgccgac aagcgacaca catatgatgc tctttcatat catgttgaac aagttcatcg     17040
     ggcctgtcaa attgaatgtc gcaggatata cagatgttgt gctcagcccc caaatgttcg     17100
     tcaagctcaa ccagcttctc gaattccaat ggtggaacac aaacatgaca aaaatggtga     17160
     aactgggaat tttggatatg ctgtagcttg gcggaaaagg aatcgaagtt gattccgcag     17220
     cgtgtgcaat aatattgttg cagactcatt gctgtattca atttttttta gcgtcatgtc     17280
     tttctcaagt cttgtgcgta tcacagacca gttatattag ttggagacga cggagataat     17340
     gttttgttgc tcaaacctag gaaaataggg attcactgtc tctgtgacaa aagactattc     17400
     tttccatttc ctgtttacct tttattaatc ctgctctata ggcgctctca aatgtggcgg     17460
     tgtgcaaagc aagaaacatc cttgggtacg gctaaataag ccatgaatac aatctcacat     17520
     agggcaaatg gtttttgcgg gggctctctc gatcgcccga taagctcata agccccgtca     17580
     caccaatcac cgtttagcat gtgataggcg catgtataac cttctgaaaa ttacggagac     17640
     tttacgagtc taatacaaaa tctattttaa gctgttattt acggttgtat catattacct     17700
     ccaagagagc agtccaggag aagactaact gtaataggta gtagcgtgtt tcgaaagagg     17760
     gttcgagaaa gaacctctct ctgtgtgtag gtggtgaaac tgatttcgat ccatcctgta     17820
     atatcctgtg gctgttaagc tactgtaccg gaagaggatc ctccctatat tgagtgacag     17880
     tggtatagcc ttaagatcct gtaccatttg tgtttaattc agattcggag agtgaagacc     17940
     cattgttact cgacgcaagg ggtcagaaat gtcgggacgg gccgagacgc gaacccctga     18000
     accgcccgac cgcgacgaac acgaaaaatc accgccacga ttattgagac cgagacgcac     18060
     caccagaccg cgtaacaact atgaccaaga gcaagagatc gaaatccagc agagaaatgc     18120
     gcgctctcaa cagaagaaga gaacccgggg caagccagta gcccaacgtg aagcggtgac     18180
     ttcggacgac gcgtcgactg agagcgacga cacgaacgcc gccaatcttg tgaaagagct     18240
     cgtgaaactg aggagagaca tcaaacggcg agatgattcg cacagagagg agatgcagaa     18300
     agtgcatgaa gaattgcaaa aagtcaagga aggatttagc gccgcccttg cagaggttta     18360
     acaggagctg cagaccttgg cagagagacc ccttcccgag ccatgcgcgc ggaacggcca     18420
     cgatgagatc cttcgcgaag tccaatcctt acgcgaggaa atcagcaccc tgcccccgca     18480
     tgctccccgt cctatgcaga tgtcgcccgt accccccaac tcagtcaccc gagcaacata     18540
     cggactctct caacgtcgaa cacaacacca accactttca ccgacacgct gtactgcgcg     18600
     atagacacct cgaagatgac cgaaagcgaa agtgagaagg catccgcggg ttcaatcagg     18660
     gccacaatcg agacagagat ccggaagatg gatgatcaca ctcactggcg ctgccgcgcg     18720
     gtcactgtaa gcccaaggga taccaaccgg atcagaatcg catgtcacga tgaagccgaa     18780
     caccagctag tgaagaaagt ggcggaaaca aagatcggtg cggaagcccg ggtgcttcgg     18840
     gacgagctct acccgattaa ggtcgacagc gtcaagagga ccgcagtact ggatgagaac     18900
     catgaaattt tgacaggagc ggcggcagcc atgggtgagg agaacgaaac tactgtcgcc     18960
     aaaatgacgt ggttgagcaa caaggaaatc gcaaagccct atggatcgat ggtcgtgtac     19020
     ctaaccaaag ggactgatgc acggaggatc ctggctgatg gatacttcca tgtcggagga     19080
     gaatccggga caaccagcgt ttttgagtac cgaccacggc cggtgcaatg ctacaactgc     19140
     caggaagttg gtcacaaggc attccaatgc aagaagatcc agaagtgcgc aaaatgcgcg     19200
     acggagggcc atcaccacag tcgctgtgat cacacggttc cgaagtcgtt ccatgcggtg     19260
     taccacacga atcgtatagc aaaaactgcc ggaaactcta cccgtcacgt catgaatacg     19320
     tcactccgga taatccagct gaatgtgagg aaacagggag cagtgcatga aagcctaatg     19380
     aacgacgaag atactcaaaa cgcagtggcg ttggcgatcc aggaacccca ggcgaggagg     19440
     attcaaggcc ggctcttgac caccccgatg ggacatcaca aatggaccaa gatggtgccc     19500
     tccacctggg gggaagggag atgggcaatc cgaagcatgc tttgggtcaa tagggatgtg     19560
     gaagcggagc aagtgcggat cgagtcgcca gatcagacag cggccgtgat tcgacttgcc     19620
     gaacgacttg tctttatagc atcagtttac gtggaaggag gggaggcgtc tgcgttgagc     19680
     gacgcatgcg gtcgcctgag aaaggccatc acaaaggtac ggcgagatac agggacagtg     19740
     atggagatca tgatcacggg agattttaac cgccatgatc aactttgggg aggggacgat     19800
     gtgtccttga gtaggcaagg cgaagcggat ccgattattg acctcatgaa cgaatttgca     19860
     ctcagcagcc tgctcaagcg aggcaccaag acatggcacg gtggaggaca cagtggagac     19920
     tgcgagtcga ccatcgacct tgtcttggcc tcggaaaact tgacggactc catgactaag     19980
     tgtgcaatac ttgggaccga gcacggctcg gaccacgacg ccattgagac tgtatttgac     20040
     gccccgtggc cgatcccaaa gtatcaggaa cggcctctac tgaagaatgc gccatggaac     20100
     gagattaatg ctagaatcgc cagcaccctg gccgccactt cgtcggaagg cacagtacag     20160
     cagaaaaccg atcgactgat gtctgcggtc tcggacgcgg tgcacaactt aacaccgaga     20220
     gcgaagccgt cgccacacgc gaagcggtgg tggacaactg acctgacaca actgcgtcat     20280
     atatatacat actggcgaaa tcacgctcgt tcggagcgac gggcggggcg aaaagtacct     20340
     cggctcgaaa agatggccca ggacgcggcg aaacaatacc atgatgccat ccgtaaacaa     20400
     aagaagaagc actggaatga gtttctcgca gacaacgaca gcatatggaa agcaacgaag     20460
     tatttgaagt ccggggagga tgcggcattt gggaaattac cgcagctcgt cagagcagat     20520
     gggactacca ccgctgacca taaggagcaa ggagaggagt tgctttccaa atgcttcccg     20580
     cccctgccgg acaagattga cgatgaaggg atcagaccac aaagagagcc agtggaaatg     20640
     ccggccatca ccctagagga ggtagaacga cagcttcttg cagcgaaatc gtggaaggcg     20700
     ccgggagagg acggcctgtc ggcgatagtt tggaagatga cgtggcccac ggtcaagtac     20760
     agggtccttg aattgttcca ggcgtcgctg gcagaaggct cgttgccaag acagtggaga     20820
     cacgcggaga tcataccgct caaaaaaccg aataaagaaa actacaccat tgcaaaagca     20880
     tggagaccga tctcactcct agcgacactg ggcaagatac tggaatcagt agttgcagaa     20940
     aggatgtcac atgcggtgga aacccacggc ttgctcccga ccagccactt tggagcccgg     21000
     aaacagcggt ccgccgagca agcactcttg ctcttgcaag aacagatcta cacagcgtgg     21060
     cggggccgac gggtattgag cctgatcagc ttcgatgtca aaggagccta caacggagtg     21120
     tgcaaaggac gtttgctccg aaggatgaaa gcacgaggca taccggagag tctgctccgg     21180
     tgggttgagg cgttctgctc gaaacgaacg gcgaacatcc agatcaatgg gcaattgtcg     21240
     gaggttcaaa gcctgccaca ggctgggcta ccgcaggctc gcccctgtcc ccgatcctat     21300
     ttctcttctt caacgcagac ctcgtgcaaa gacagatcga cagccaggga ggagcagtcg     21360
     cttttgtgga tgacttcacc gcatgggtga ccgggtcaac cgcgcagagt aaccgggaag     21420
     gaattgaagc aatcatcaga gaagcgctcg actgggaaag gagaagcgga gcgacctttg     21480
     aagctgagaa gacagctatc atacactttg ctcccaagac gcgtaaatcg gaccacgatc     21540
     cgtttaccat caagggacag acggttgtac cccaagacca cgtcaagatc ctgggcttat     21600
     tgatggacac gagactcaag tataaggaac atattgcaag ggccgcttcc aagggcctgg     21660
     aagcagcgat ggagcttcgg cgacttcggg gcctaacccc accagcagcg cggcagctat     21720
     tcacctcgac ggtggcgccg gacgtggact acgcctccaa tgtctggatg cacgcgtgca     21780
     aggataaagc catgggaccg attaaccgag tccaaagagt aggagcacaa gctattgtgg     21840
     ggacatttct cacggtcgcg accagcgtag cagaggcgga ggctcacatt gccactgcgc     21900
     aacatcgatt ctggaaacgg gccgtgaaga tgtggacgga catacacact ctaccggaaa     21960
     ccaatcctct ccgcagaaat acagatcgga tcaggaagtt cagaagatac caccgctcgc     22020
     cgttgtatca ggtagccgac gcgctcaagc atatcgacat ggaaacactg gaaacgatca     22080
     acccatttac gttagccccg tgggaggaac gcatgcagac cgatattgat caaccgcagg     22140
     atctccagac cagaccaggc gtgtacatgc agatcgcggt cagcagctcg gctcggaaca     22200
     agctggtcgg attcggggtg gcgatcgaga aacagccacc tcggtatcga aaactgaaac     22260
     tgaagacgct ttccgtcaca ttgggtgcaa gagcagagca aaatccgttc tctgcggagc     22320
     tagcagcgat ggcacatgca ctgaacatgg cagttggagt gaaagattac cggattacgc     22380
     tggtcacgag caacaaagcg gcggctctga caataaggaa tcctcggcaa cagtcaggtc     22440
     aggaattcgt ctcccaactg tacaagttga tgagaaaact gaggagaaat ggaaaccaca     22500
     tcaatgtccg gtggatctca acgagtgaag acaataaact gcggggtctg gccaaggaac     22560
     aggccagagc cgcgacacaa gaagatgctg tcccgcaaaa gcaggtccca aggatgaagt     22620
     caacaacact caatattgca cggtcccaag cagtccccag caatgacctg ccaggtaata     22680
     tagggaaaca cgcaaaacga gttgatgcag cactcccagg caaacacacc aggcagctgt     22740
     acgaccgatt atcgtgcaaa gaagcgagcg tgctggctca actccgaacc ggcatggcaa     22800
     gactctatgg acatctctat cgaatcaacg tggcagacac agaccagtgt gcgtgcggac     22860
     aagcgagaga gaccgtggag cacttcctat ttcgatgtca aaaatggacg gcgcaccgga     22920
     cggaactact aaaatgtacc aacacccacc gaggaaatat gtccttcttc ctaggaggaa     22980
     agtcgccttc tgatgatcag aagtggacgc cgaacttaga ggcggtgcgg gcctcaatac     23040
     gattcgccat tgccacgggc cgactcgagg ccacctaacc aagccgacga acataaatca     23100
     cccctacttt ttcgccgatc taaccacctc gtgttacaga tggtagacgc gcttcaactg     23160
     ccgaaaatag gatgttgaac acttggagaa gcgccttcaa gccagcctac taaccaaatt     23220
     actaacccac gaggatccgc tgtgatacgg acatctgaaa tgacatatat tgcaaggctt     23280
     tatgtatggg ctctgaggag acacagtact atatatatta tgacatgtat agtagatcag     23340
     agatagttgc cctttcggct tagccgccgg gcgttaataa attgtgtgtg tgtgtgtgtg     23400
     tgtgtgtgta ctacgactac gagcgaacta gcactcctgc ggggatatca cccaacggaa     23460
     attcgtttca gacggcacta ctagaaccca atcgggtttc aatcgggttt caaccgtgtt     23520
     cccttatcag cagaacatgg ttgattgcat taacttggga caccacttcc caaaaagcaa     23580
     ttgccgtcac ttcgatccgg gattggttga aatctgatct gtcgttgccg aggcataaag     23640
     atgaaggaaa ctgagacata cgagtttgac ataagtcaga aatcggttcg aagacccacc     23700
     ctaccaagga attcggcatg cgaacggccg gtcgtacttg gaacccggac gtgctattcc     23760
     aaactctaca caccaaccct tcccaacccc cacttgatgt cacagcccat cacgctttat     23820
     cagtgacgtg tgattaaagc cggaacctag ctaagtcaag tcgccagaac ctggcaaggt     23880
     acttcgtgag agtcaatcgt aatcatagca cccagcccgt tttcccatcg tatccattct     23940
     gtcactgctc tccctcttca ccagtgattc ttattgttcc ctggacagct agctgcttaa     24000
     tttacgctag gggcacggat tacttccggg tcaggcttga aaactgggat ccgcagcggt     24060
     gcagaattcg tagggcaata cttgagacca gcaataccat gccaaaggac ttgggaaggg     24120
     gcaaagcacc cggaaaatct aaatttcttc ctgtatttgg ttactacacc agaagactag     24180
     ttataagtac ttttctgcct agatcctcct attggtatga ataattgccg atgccaagtg     24240
     ccagaattct tcttctggaa cgggtacaag agtttcactt ctcgttcatt aaccgctgat     24300
     tatgttgctg gaaagccgag catacttggt gccactgtca gattctttcg aagacgaccg     24360
     ggactcagcc ttggtaaggc caagtccggt agccggtatt agggacaagg ttgacgatcg     24420
     gagtcttggc ggggactgtt acagaagcgt ccggtctggg tttgccatgg gttgtatggg     24480
     cagcaacaat acgggcagca ggatggccag cacgttgtgg ttcggagcac attttgaatt     24540
     aggggcagag tgcccgtgtg cccaccggtg ggtaataatg ctatgaaaaa aaaagtctgg     24600
     ctcaaccgtg tgttcttgat ggcaggacga ggaatttagc ttacaggggt agcaatggac     24660
     atgtttactg tggagctggg ttgagcgaca ttgtcaagtg tgttttgaag actgatttcg     24720
     atgtctgctc tacatacttt atccatatta atgatatcta atagcgatat atccgggacg     24780
     ttgatgggct tcggtcggag caacggaact ctggcgtact ggggataacc agcacagcgt     24840
     tagtgtatag taggccgaga aggaagactc caaaaactgc caggtctgaa ccgccgacgg     24900
     gtttgaatga tactactaag tctaacagtt attagaccat ggaccgcacg gtattccgag     24960
     aaagctatct gcacattaat taccaagatg gtcctccctg ttcaatgtgg aaattatcgt     25020
     gcgatgacca tgtatgtttg ctagcacccg ttatgactcg caactttact agtgcgctcg     25080
     agggaatatt cagcacccca tctgcctgat gatcgaaagg ctctcagcga ccttactaag     25140
     ctcatcccct atctattctg cagtttctat agtatataaa atccacactc tcgggtactc     25200
     aattggctgc ccgtactgta acgaccacgt tccggcagga ccatttataa ttgtaagatt     25260
     agcagttggg tataataagg gagtaggata cttacatcta ctgagtgtat tttatattct     25320
     agcatcgagt caagccgcaa gaaaacacat gtcaaggaat gggataatac ggccttaata     25380
     cagttgaaac atgtggcttt ttttgttatt atgcattttg cttattaatc atgtccgacc     25440
     ggattgtcca aaccggtaca ttacgtattt tagtggggga attttatcat cgtgaattta     25500
     ccagtacgct cgctatgcac gtgatttctg tcatataata aaatgttcga gcatgtacat     25560
     ggacgtgcgt ctagttgccg tggtcagcaa ttagtaatgt tctgccgatg ttctgctgtt     25620
     ctgcctcctt gaatccaggg tatcgttcca catacctttg gagacgcaga ccctttcgtt     25680
     ccaactttat aatcttcatt ctaatccact tctgggagac agacgctctg agtttatatt     25740
     tcctttacaa cttgctccta agtctcgtga aagccatgat tgttgacaaa ataaaggata     25800
     attatccgct tggaaatctc gcacaaaacc tcgccttctc tctccaaatg aagggcactt     25860
     caagcgacat ggcttacact caatatcatg gagaaatcca agctctacag tgatatcatg     25920
     atgatagtga ctccaataaa catagtaaaa ttactaaact tcgaggcaac ctgcgctgtc     25980
     gacagtttgc catttcttta gactcaagct tgattgggta gatcagggcg ttgatggtat     26040
     agcgcacatt ggccgaaaga ctcaatgcta ccaatggtgc cgctacttat actgctgcag     26100
     tgcggatgct ggtcccatgg ttttcgtcca aatcaacgag agaccatacc tgagaccggg     26160
     tataggtcag cgtggcgaga gcgtaatctt ctataaatgt ccgagaatag gtcgaacagg     26220
     gtttctctac gagaattgga gagtggctac ctgtagaggc acaaggggaa gtggcaaggt     26280
     gcgttctgaa ttgctacgtt gcgctactta cgttaatccg gggaaaagct atatctcaaa     26340
     ctttgattgg actcgtcgcg gtccactgct ttgcgtattt ctgcgtccga atagactatc     26400
     gtcggactta gtaccaccta gcgccaactt ggtcctgtag gtacgaaggc ataagtggag     26460
     tcttcctgaa gggatgtatt ctaatgaagg acaatatgat acaagactaa ttgcccatct     26520
     ttcgtgtata gagtctgtat cagctagcct cagccaatga tagaagctgg gttgaggtcg     26580
     gaataataaa ggcaaaggct gggggtagac gcctggtcgg tgtgcgattg ggaaagcgaa     26640
     atatgatggg ataatgaaac ctataacaga atggaagtag ttgaagatga aatcgggccg     26700
     ccaatatgta gtacttcagg atctggggat gaggtctgtt tgaaaactga taggggagaa     26760
     gaaccaactc aactcactca actcgcaact cccaaattac acggcatgca ccatgacgcc     26820
     aatcacattg cgcccactca agggagcccc tgaatcctat gacgtcatta tagagaatgg     26880
     gctggttacg gtgaatttga ttggaatgat gctgtgataa ggctctggtt gtgtggaaaa     26940
     ccggttcagc ctggatttaa tgcttgcata tccatcaccg cttcactatt gtttccatac     27000
     tgatatgcac tttcttgtcc gttaagcgtc gctagcaatg gctgcaattt tgggcctcag     27060
     tgcgcagtca cattccagac tggcgcaaga gcgagaattt tacaagtagg acctcgtgcc     27120
     accagttatt tcgagacagg caaaactacg tgaacttggc taactacccc ttggttgctg     27180
     accttgatgg tatatttcgc aaactctttc ttggtgagcc ggaaacactc cgttcagcct     27240
     tcagggcatg gtccctggac ggctgtgctt ctcgctgttt cttccagcac tgcgcgacca     27300
     catggccgcg cttcttgcaa tagttgcatt tcttggcagt ctgctgcacc gtattgacgg     27360
     acgggccaga cgctgcctgc aagggtgttg gtgactcttt cctccgaacc gtctgttcgg     27420
     cattagacag acggtttccg atcgtggtcg gattcaccgg atccttgtca ttctgaatgg     27480
     catccacaat caggacatat tccggtccaa tctgcgtcag caagatcgcg atgtgtgctc     27540
     gatcgccgat cgacccgggc gcgatagcat ttgatcgatg taccagcaac cgtacacggt     27600
     caacgaattc gcgcgcactg ccgcagcgct cgccagtggt ttcgcgaagc tgggcgaaca     27660
     gctcgcagaa tgtgacgagt tccattcgcc ggtaccgttc ttcaagttca ttccagaggt     27720
     cgcgagacgt ctccagtccc gcgacatgaa tgctgatgtg gggggacagg taccggaaga     27780
     tagtgtggta ggcctcggct tcgcggcgcg accattcacg gtggcgctcc tccacttcga     27840
     ggcgcgcttc aatggtccgc tgcctcaccg ccccgttgag gtggggctcc accaaggggt     27900
     ggatgtccgc cgtaataggt ttggcgtact tgaatagaca gtcgggacgc tgaaggtcgc     27960
     ccgacacgac atcccagacc tgcctagctt tgagatagga ggtcagaggc gtttccaggt     28020
     cgcgaagttg tcgcttcctg tcaaaggctc gatggccgtg acggctcggt caggagagtc     28080
     atggaccaga gcagacatag tgagaataat gaaagcgggg tagatatata atcaagatgg     28140
     tcaagatgat tctcggatga gtagaaacgg cacccgagat tttgctcccg gactcataac     28200
     ctgttgtaat tcagaggtat attctttatt gtttcagagg gaaacatgag gctatatata     28260
     caacgagaag atcaagttgg tttccaatca acttgactct tcgtatagat aactcgggct     28320
     taatctcgat ggtgcggctt ggttcctgat ctgcaccggc ctcatatcac aacaatagga     28380
     agattgggat ggtcgatgcg aaagtcaacc tgctccctgc aacagagcta tgggttgcta     28440
     gtgggttttc cggtctgagg gataaagtga ctgctgccag ctacgttctc gcagcgacgg     28500
     ttactcgaat ttgattcaac cctctggtac ggctcatccg cctcggggtt gtaaattcct     28560
     gcgagctttc cagcctgagg cacgaaagtg gtactggcag cgacattccc acgatgactg     28620
     ttatcctgat ctgaatatac tctagggtcc agcatgttgg cgattttatt atcgtgacga     28680
     ccgcctttgc catagttgtg tgcatatcct aaatgggcgt ctgggacatt gtggcttcct     28740
     gggaaattaa tcagacctga taagtgggta caacaactga agaagcagaa aggtgagctg     28800
     taccactgtc gactcgaggg tcgagtttat tagcaagctt ggagcggtga ggtccgctgc     28860
     tcgactgttc cgacatagtg acttttggtg ccccgcagtg gttatcaaga ccagattaag     28920
     taactttgct cgttccccga gcggtatctg taatatatgt gttcgtgcaa atcttttgcg     28980
     gattacttat attacgtaat gtgacgaatt caaaggaaaa ccagtgggtc gccagcttgc     29040
     tcatgcaaat ctaaacccaa tctcgtagac tattggccct aacggatttt tctagcccac     29100
     aaataacctt tccattgtat ttctattgtt gaaccataca tatgcgccct tggtattcaa     29160
     acaaatttcg aatatacaat aacaaacgta cttgtctcga aagattctcg tggatcgtgc     29220
     cttgactgag ggtccaaagc aataggagaa ggctgtcact caaccacatt cacgaataga     29280
     ctactacctt atgactacat ttaccccgta aacaggcatt tgtgtgtttg agccgtggta     29340
     aaataaatgg tctagcaatg acgcacgaca tcatcggcca agtttaaaat atttcaggta     29400
     agtatacaac aactcgtccg aatggacctc gctgactcgg attgtacaac aggggaacac     29460
     cctcatattt ctgtcactcg agtcgaatgc gaagcgaaag aagtcttgtc tgctcgagct     29520
     cccctatact actacgaccg cttgcttggt ccgaagtaaa aagtgaacga aaaaatgatc     29580
     aatagtcttt gctggaaagg ccgttcctat atgtaaccgc gaggtaagaa tatcatatgc     29640
     caggctgtac cataaaatgc taacttggaa gatcaccaaa gattaagaag atccgggtgt     29700
     aaccaaaaca ggtaaatacg gactaacagc ttcgtcttca atgatctgac gtcacgtcca     29760
     agatttttct gaaccccaat gccaagctat gccaatccat atacctacta tactatggtt     29820
     cgataaataa tcaatgtatc atagaaatat atgcattgca gcagcttcag tcacaaaact     29880
     ggttcattcc cccatcatct gaagttctgt aaaaaacact gtaaagaccc aaattggact     29940
     ccctaatagc tatcgaagac aatttgctgc acagaaatgt tcagctttgt tttgacttat     30000
     gccggacaca tctggcaatt gactgtacaa ttcttccctg aaatatcgac cagtactgtt     30060
     cttccctcag gaacactaag tttcccagtg tagcaagggg ttatttctgg tggaagagtt     30120
     agtttatcca tatgtaggta gatagatata tgtggaatgc tgaactcaca ccgcaggcat     30180
     tgcagctgca atcctttgtg gagcaagtgc agctctgggg tccagcgcag gaacatgtgg     30240
     atccgcagtt gcaggccata tttacagagt aatgggtagt ggtcgctgaa cctattgaat     30300
     gttccgagag caatctgatt gatggtttag tcacaaaatg tctggggacc ttgggagcct     30360
     ttataacttt cgacgtgcat gtaaaagggc gaaaaggaaa gatcggatac agacgtcacc     30420
     cgtggtcata aagtggcctt gatttactac tgtagagaac aagtactaaa cgtcctcatt     30480
     atagaatagg tagttgcgtc atcggccaaa tgaacggata gcttgtccta attcctattt     30540
     agtttatgtc attgtcaatt caagggcaaa tagttagtca gtcactgtcg cttacgtgcg     30600
     aacacgcacc tggcacacct tgtcccctgg aacacttggc tgattcccaa gcttggtatc     30660
     tatccaagat accatacgta gaatgaagtc ctacctggct cgatgcagcg tatcacttta     30720
     tgtagtacca tggtgtcggg tcctccacat tcaaatgcta gtgagaaaga aggtataact     30780
     acggagtatc tctagggacg aagatggatt ggcaacgccg ggtatgtggt ctgaaagtcg     30840
     gggaatacaa tgaaaaacta ctcggagaat atatgtttta tttaaggcag attgcttcca     30900
     gaggtctgga tcagacagag ccgtcgctac ctgttcaata gtatcagtac aggacatttg     30960
     ctggagacct gagatgtttt cgcgtagttc gcgcagggca ccaaggcaca gatactggat     31020
     atagctgggg ccctgagata ttattgcgga gtttagcaag aaatgccaaa ataggcgccg     31080
     gcaaaggccc acggccgcat ctcccccggc ccccgggccc cttgtaagaa cctgattcac     31140
     tctgagcatt cgttgccccg ctacgcccag ccgatgaatg ttgatggtcc gtactatggt     31200
     tacaatactg gcgtggatcc aggaagtccc tcggcaaggt gtataccgct ccgtttggca     31260
     gatcagattc gatttgaact aatattgaac atagcgattc gtacgagttc gggttcaaga     31320
     ctgattcgga ttcgattcga agttcgcaga attttcttgt tttaaagctt cattgggatg     31380
     gcggtcaatc acgcctgttg ttcaaagcga tagccagaaa tcaacacctc atacagttag     31440
     actaataatt aattaaacaa tagttagtta gatgcagaga aaagtagact agattcaggc     31500
     tgatatcaga attgaacaat ctggccttaa gattaagaag ctgtagggca gtatcaatag     31560
     atgcaattcc tgtccaaaac cttcatccaa atatatatta ttcgactcct aatgttactt     31620
     caacaatcga taaatttaca tgtggtctgt tttgcttcaa attatactag cgcatagatt     31680
     gtactgggat acacgtaata tatcaatata gagccataat aagcatagtt gcacattgca     31740
     tttgatggag agtagatgga taatctaatc ggttagcgga gactccataa gaactttttg     31800
     ggctgggaat tcggctcctt ttatgccttt tcggctacgt ctcttcaaag aaaccagttg     31860
     cgcagatggt agcgcgaatc actgtcgccc ctggcgagca cgtcaggtaa ctgctctcgt     31920
     caagcagtta ggacggtgga tttctacctt ctcgtggtgt ccggtgtcag taccctctca     31980
     ttctgtgaag gggaagccaa aagaatccgc gtggggtgaa taggggtcgg gccgcagagt     32040
     tttccgtggt tgacgacacc cattccaccc cacacaaacc agaggaaaac gggctatgaa     32100
     aaccatccga cgactgccta ctcgactcgt agtcgagatc gaagctggac ttgttcccca     32160
     gtggttgtgg tatcgcctag gcaggggaca ggacacctct gagcttaaac accctctgag     32220
     attgcgagac gccaaggaac ttgaatgagg gaaatatcga agacagcaca cgaaatatga     32280
     gacgaacaaa cggaaacaca tgagatgatg ttgagcggcg aggggaaata caactggtgg     32340
     cgcagcaggt tgagcaagcc gttcgggagc tccatggaat accctggtcg gaacctcgtt     32400
     aaagcaaagc tacgggcaac tctgaccagg acatcctgtg gtctcttcca agcggggtgc     32460
     acagtctggc gacgaccctc gacgaactcg ttaaggcaca gccacggggg ctcgagaggg     32520
     ctgcaaaact agggacacaa gtttggttag tgaaggacag ctggggtatc ctgcaaggtc     32580
     aatgaggata ctcctggcca cctttgcgag acacggtcgg ccggtggaga gagatctctg     32640
     ccggtaacgc gaagtaggga gacttctccc tgtggggcgt ggtacatagt ggcagtgacg     32700
     gacgggtcga gaggacccga cgagactgtc tatgtggccc gagaggacgg acgcgcgtgt     32760
     cggtgtgcaa atagacagaa acagctacct cactcgcact gaggacctga aatctaccag     32820
     ccaaagtggt gtcgtcctag tggggcaggt ccgacctgtc tttactatct cactcgcact     32880
     gagaacctgc agctgggcaa tggatgtgat gtcgttctag ctgaaatgct gatgatgcat     32940
     gcttaaggag caaacctgga gacacctggg gtgagaggtt tttgccgggg cctcaatatc     33000
     tggagggcgt ccatcgaaag atgcgcgtgc tgaaaaccag ggcagtggcc tgaacaagcg     33060
     gcctggtgaa gctgctttac atcagtcccg agaactcgtt aagacttggt cacgggcagt     33120
     cttggctgtg tagctatgtc tcttggccga tcactctgct gagcacgctg gggaaagggc     33180
     tcgagtcagt cagtgctcgc tacccgattg agctccctag tcgaggccca cacactccta     33240
     ccggatactc acatgggggg gagagtcgga aggtcatgcg atcacgccct tcacctcctc     33300
     ttagagcgag cgtacgattc ctggaggcag gatgcacacg tcgctaccct gctaacactt     33360
     gacgtgaccg gtgcgttcga tcatgtggcg catgagagat tggcccattg cctaaggaaa     33420
     caaacgatac cggagcaaat ggtccggtgg atcctcagct tcctgagtga ccgctcaacg     33480
     acgctggttc tacaagaagg ctcgatgggc tcacacccag tggccacagg catcccgcag     33540
     ggctcaccgc tatcaccgat cctctatctc ttctacaatg cagacctcgt cgacgaactt     33600
     cacgacgccg cagccggaca agcccttgtt acagagtaca tcgatgatat ctgtatcctg     33660
     gtatggagta aatccgcgct agacaactgc cagctcttgg agagattaca ccaagtcgcg     33720
     gatgactggg ccagtcgcca cgcatcacgc ttcgcgcccg ccaaatatgg actgatacac     33780
     atgtggaaga agggctggag agctcgaaga gtagatcgac cgccgtcggg cgagagcatc     33840
     acccttcaag gcgtcgaagt ccggcccacc tcgttactca agtacctcgg cgtcatgcta     33900
     gatgagcacc tcacgggaga aagccaaatc gcgcagtgtc gcaagaaggc cgcacaattg     33960
     attgccgcgc tacggtcaat tgcggggatg acatggggcg tttcgaccct acacctccgc     34020
     cgcatgtgga cggcagtcct actccctcag atctcattcg cctgctccgc gtggtataca     34080
     caaggagcat acggctctaa atctttcgag ggtcgagcga atagcacctt tcggtcgatg     34140
     caacggcagg ttcaccagta tatcgcaggt gctttcagga cgatagctgg gtcagcccta     34200
     gagatatgtc tcttcgtccc accggcacca atcgccatac aacgcctcgc ggaagaggcc     34260
     tgtcttcgca tacatgcatc acctcttaga tccacacccg ctagacgaag cgacgaagga     34320
     cgacgatacg gactagtgtc gccactcaaa cgactggaga cacatcttaa gttcaaagga     34380
     atcgaagtca ataggatgga gctgatccgg ccgttcgcgg tccccccttg gtggcaaccg     34440
     ccagcgaccc ggatagcacc ggacaaggac accgccatca aggaacatga tctgattctc     34500
     cgggcgacac ctctctacgg accaaactcg gcgatcgcct acacagatgg gagcaaaaca     34560
     gagggcgagg gcgtctgtgc ttcggcactc atatccaaag ggaacgcaac cgccaggctc     34620
     aacgaccagg atacggtgta cgcggttgaa ctaaaaggta tcctactcgc actcagccag     34680
     attaaagatg acctggtgag agagctcgcc gctacttcga gagccaccgc ccgcacgatg     34740
     accatcttcg cggacaacca ggccgccatc caggcagcag attctccgca acatcgccat     34800
     ccagatagaa aacctacgac tggcggcctg gcgcatccgt atccactgga tacccggtca     34860
     cataggagtc cacggaaacg agcgcgctga cgtcctagca aagctcgcag caagtacata     34920
     cgcgcccgcc gaagcggcca tcctcctttc cggctgtcgc actaagctcc gcgagctcgc     34980
     tgcgaaacgg tggaaggagg agtgggcgtc aagcaacagc ggcgctcatc tccgcgcagt     35040
     tttccctgaa ccgacgaaag agatctttgc gatacacgag tccctgagac gcgcagccag     35100
     ctcagtgctg gtacagatgc agaccggtaa gattggtctc cccgcttacc tcgctaccct     35160
     cccgcagtgg agggaacagg ccctagaaga taacccacta cgcaacccat cgcgttgcac     35220
     atgtgaccaa ggccaccatg aacacgcacc acatcctctt ctcctgcccc cgtttcactg     35280
     aactccgtca acgaattctt ggtcttgacc gaggaggtgg gagcgaaggt gaccaggacc     35340
     cgtggaaaga atggctctcg aagccatcgt tagcagtcaa agcagtcaac tttatgatgc     35400
     gaactgagct cctaggccaa ttcaggagcc taccgaccac ctaccgagtc accaacaaag     35460
     tagactcgtg accctgggat cttaagatcc cctcgcttgc cccaatttcg ggccaccagt     35520
     actacggtga gtactcccct gcgtcactga tcaccttcgc ggcttgccgc gtgagttgct     35580
     ggacagtttg agcttcggtt ccgtaggtat gaaagcgatc gactaaagac ggggatggcg     35640
     gttttcgccc tgtttccttg gctagaaatg tcagcctctg ccggagtttt tatggggcaa     35700
     tcagccctgg caggagcatg gttagaggtg aggttgagat tggaggaaag tagtgtgggg     35760
     ggagcttcgg aacagtggag aaaatagtca tatagtcatc gtcatgtgat atagttgccc     35820
     cggctatctt gtagtgcctg ccggcaaatc gggcctcacc gcctgacgga tccgcgaatg     35880
     aaaattactt acttactaat tacttactag aatcactctc gttgataggc gttgaagcga     35940
     tttgaacgac gttgaagggg tgtttggaga ctttgtggcc tacagagtca agtttcgacg     36000
     tggaataatt cctctcaaaa attgtgcgtt gagtgtggtg aaccactttc cgtcaagtgt     36060
     tgaagagaaa ctaacgccgc aaaagtatga ttcgtacgta tcatcgaatt tgcaattaaa     36120
     tcgctcaacg cgcttgcact ctacatctcc ccgttttaac cacggtcacc gtctctttca     36180
     tgagggttga agtgcttcga cagatgccga aataatgggt tggagacttt atggccgacg     36240
     gaaacgctgt gccgtacctg cggttggccg gaggacgctt tggtctcact agaatcaatt     36300
     cgtccatctc taggctcgcg ccgctgaatg ttattccttt cctttctgct cacagctaac     36360
     ttatgttgcc tttactaaaa tctctactcc ctgtgcgcat aggcactggc atacttccaa     36420
     tctaaggatg aagactgtct ttctttggga gggcatgaca tccaaaaaaa gcccagaccc     36480
     tttgaaaagc tcagacaaga aactgggtct agtctccagg acaaccatgt gaactgatgc     36540
     aacgaaggct cacgagctag gttgtcgtga tcgccacccc ctcgcaagat tgcagcgcta     36600
     ctatcacaca gtgatgagaa cctggacaca aataggatcg ggcggaccaa tcaaacacca     36660
     cgcgtgaatt tagacagacg taggtacggt tctgcgatgc agatcccagc gacgacccac     36720
     ggggcggtag atcaaggagg ttctatttgt ggcgctgaga taaattagga agaattgcaa     36780
     ggtccagaca cgatccacaa gcccaaagtt ttcggccatc agtgtccgat ggaacgggac     36840
     tttgttgctt aggaggtact gctggggcgg gcgagtattt ggaatatcac aggctttggc     36900
     gacagaattg taggctacag tacaacccaa ccgtggttgt gttctcccgg ttgcagtcac     36960
     aagagatcat gttcccctat caagtggcaa ggtgctcttt gtcagtctgg tctgtagaac     37020
     gttctagaag ctatgtatct tctcctgcac caagctttcc cctgatgatt atactatact     37080
     ctctttgagc cataacaaca cttcctctcc atctgctcca agtctaccgc tatttcaata     37140
     actctagcag acggcttgta aagaactatg ccaattatgg accgaccgca tgagcttaaa     37200
     taaaatgtct ccgttttact aaaaccgatt ggctccggac atgattcgac gtggaccggc     37260
     cctcctgcgg ccctaaactt catttcgatc aatctgcaca tcttgatcat gatgctgaat     37320
     ttagagaaac tcttataaaa tattggccta accgcagtaa atttattcta catacaagcc     37380
     gacggagatt gtggtgattc tgctctagtt ctcttttctt ttgggctgca aagcttaatc     37440
     ccgagcagcc cagaaataaa gtaggcagaa acccaggttt gaattcttca ttacaaccgc     37500
     attctctcac cgagcgagca tttccatggt tcatccaaac gagctctcgg aatgatttgc     37560
     ggttccgcta ctgatcggca gtcccgctcg tggttccgcg atctgtgtca aacttatttt     37620
     ccttgtgact tgggcgtaga cctcgccatg gcccacccat gggcggggag ttgggcgccc     37680
     atggggccgc ccacgcagcc catgggcggg cagggtaatg ggtcggcccg cccatgggca     37740
     gcgcagggcg cccatgggcc gcccatcaac cgcccatcag cgcacaactt tcccaaacag     37800
     gatgaataaa tcgctgattc agcccgttaa ataccgttta tttatacacg ttatattcca     37860
     tacattactt gatgtctaaa atgaagcata ctttctatgt aaaactggta aatctcgctg     37920
     tattcttgtc cgttagatca tgtttacagg ccagatgttc tttgaagttg aatatcagct     37980
     gttggggtca attaactaca aaaggcacgg attcctctga aggtgcactg aagatatata     38040
     tatctatatt gcattgtcct gtgtattcgg atcttacaat tgcaactata gtttgtagta     38100
     tattagatgt gttttctatc aaaagtaaag taatattatt gatatccata ggatttatct     38160
     accatccttt tttttgaaag ctatttgagg cagaactcat agtttaaaga taaaactatc     38220
     agacaaaagc tcggggggac tacaagtcag cgaaaattcg cgggaaatgg gcggcccatg     38280
     ggcaatgccc atgcgccata tgcgggctgc agcaaatatc ggccaattaa accactagaa     38340
     accatagatc agcagccatt ttatgatcta tcagcctcac ataatttttt ctaacgctaa     38400
     agacttcttc tttctcttag ttatagcaaa gaaacaattt aagtctctca cttcttactc     38460
     tctctatata ctacctttct caattttgta tactatgggg tctcaactct ctgacatcta     38520
     ttcctcgtcg gtctacgagg gaggcagctc agaacgcttt ccctacccta tcccggatga     38580
     ttcattcatg cttgacccac cgtctagtca gcgaaccctt acctcagtta ctgacaccga     38640
     attgattcaa ccccctccta ttcctatagc cctcgaacgc gttggacccg accgacacaa     38700
     atcctttgtc ttatataccg aaatgagcaa agacgacttt ctccactggt ggctccagac     38760
     agagcaaggc agcaagcagg gtagcctaca ggttaacgca gatgatagcg agaatgnaaa     38820
     aaaactccat tgggatggaa cgggcaacac atcggatatt tggactcgct tcaaacagat     38880
     agcccattat acgtctggcc taccaaaggt tatgtgcgag agatgcggaa aggtcttgga     38940
     acatccaaac tggagctcga atggaacgca ctcgttacga aggcattggg aggggccgaa     39000
     atgccagaaa tctggtgcga aagcaaacaa gcagcctcat attcgccagc ttatcaaaga     39060
     ctcggtgagc atttttatct tttgagactt ttgttcctcc ttatgctaat gattgttcaa     39120
     catatcttag gcgtctcata ctcgtgacaa tactatttac ttctcaaagg aacgatggga     39180
     gcagcaaatc atgaaaacta ttactgttct ccggcttcct ttccagattg tcgaacatcc     39240
     tgagctacaa tcgctactcc gcatcgccca atccgccccc tttcctcttg agtttccatc     39300
     agccaaaacg gtacagcgcc gaattcgtga taccgtcaag gagtctcata aaaccataat     39360
     tcaaaatctt ccgccgaatg caaagctttc aattgcattg gattgttgga catccccttt     39420
     ctctcaagca ttcatggcta tcacgggcta cttcattgat aaggactgga actatcgtga     39480
     gattttactt ggcttccagc cacttcaagg agcccactca ggtgctaatt taagcgcggt     39540
     cctcttgaaa atcttccaac aacatcaaat tgtcgatcgg gtgctggccg tgacgaccga     39600
     taatgcatca aacaacaaca cattgatcac tagtatccag gagtcaattc aggcactcga     39660
     gcttgatgag cagattacta taatccgcat tccatgtatc gcacatgtga ttcagctcag     39720
     cctcaataag cttcttagtc ggatcaaagc caatccgaaa aatcaagtag tggaaagaga     39780
     gtggtcggag agtcggtctc aagcgcttcg atcgagtcaa cgaaataaag agattgcaaa     39840
     tacactagaa aaggtaaatc atattccacg tcgcttcgct gtcgctctac tgatttatta     39900
     caaagattcg tggtttagca gttttcatta atggaagtcc acaacgccga gatgctttct     39960
     tgagtcttca gacagaagaa ccgaaactgg ttccgattca agacgtacgc actcgctgga     40020
     actcgacgtt tctaatgctt cgacgcgcaa aacgattgca gccgatcttt gatgagttct     40080
     gctcacatta cgggcatccc cacttaatgt tggatcgaga ggagtggcgt caaatcgact     40140
     accttcttta ccttacgaaa cctttcttcg agtttacgac tgctctttcc cagacgaaag     40200
     acgctacaat ccatagcgtc tttgggatct atagccagct atttaaccat cttgaaatct     40260
     caattggcca gcttaaacca aagcaagtcg cctggaaacg attgatggtc gacgcacttt     40320
     acgcagcaaa agacaagctc tcgcagtact ataacaagat tgctgagact cataataacc     40380
     tctacgcaat tggtactatc cttgcgcctc aatacaagct tggctttttc gagcaagctg     40440
     cttgggcgga caggaatcat tattggcgga cagaatacca taacaccctg aaggaacagc     40500
     taaaaccata ccaacaacgg ctttatggta gtcaatcaac acctatcgcc cagtcaccgg     40560
     tgactcagcg ctcaagactt caattccttc ttacaaggcc aagaaaccat caatcgatac     40620
     caaccccaca gcatgatgat gagctttcac agtaccttaa aaatggtagg ttcttcttcc     40680
     ttctttttta gacaccgtaa tactagtatt gatgcaattc agggaccgtt gaggttgatc     40740
     ctcttacttt ctggagagaa aatgagcgcc aatatccggt gctagcaagc cttacacgcg     40800
     atattctctc tattccagct accggtgcag gcgttgagcg gctcttcaac tctgctcggg     40860
     atatctgtca ctatcgccgt ggatcactga atgctacaac aattcaagat ctgatgatgt     40920
     ttatgtgtgc tacccgattc gacattgaag agaaacagct ggcttttgta aaggacttcc     40980
     tcacaaagga agaacaagag atagcagcag aggagaacga tgctcagttt acgcatgatg     41040
     atctgaatga attaattagt gatgatgaag aggaggatca tctcccttct gctgaggatg     41100
     ggattgcttt tgacgccaat gccccgagaa catcctgtaa aaggcgaaga aatgatacgc     41160
     ctacggagca actagaagac ctaggagcag ggaaagaaaa tgaagataga gacgaagaag     41220
     aagatgaaga tgacgacctt cccgttggtc cagcaattct tgaagaaaga agtactcagc     41280
     gtgagccatc aaaaaggcgt cggatacgct cgaggctttt agatggatat gaggttgata     41340
     tgtagctatt taactgatag atatttggtt ttaataacga tgaatatggt gcgaactcta     41400
     aatgacactt agaatcaagt tgaagtctac acaatatcca tgaaaattca tccacacgat     41460
     acaattcaat atcataaaat acaggcggaa tacgcataaa ttgtgcaagt cacggggatt     41520
     ctatatttac ttttttgaag gcccatgggc cgcccatcaa aagcccatgg gccgacagtc     41580
     aaacggcccg cccgcccatg ggcaggtaga agtagcccaa tgcgggccca tgggccgccc     41640
     atatgggtaa aacccatggg cctcatgggc cgtggcgagg tctacttggg cgtgggtcga     41700
     aagcagatcg aacgcttcac tccaaagatc actccgcctt cgaccaccga tccaattaaa     41760
     tcccatcgga catatttcct tgggctaaca agaacccaga tattttcagt ttcccagagt     41820
     ccccttgcta ccctgtccta tctccctatg ggaaaacgca tagtaccgta aatccttata     41880
     cactgtccgc agtattttgc aggccgcatg ggccatgccc ctggtttaga atgacaagga     41940
     tgaaactgtg taaccgggcc tgctcagagg caccacaatc atgctcgaat gttcaccttt     42000
     aactttggaa cttcctcact attgttgtaa ttccaaataa gggtgattgc tccttcctat     42060
     acggaatcca tgaagtgata catatctctc atgctgagga ttcattgtcg agtaatcaca     42120
     gcctttatgg taataacata caccaggact actttatcga aatgcttggc cactgttcct     42180
     ccgacatagc aatgtagcac tccagccgat gtcatgctgc tagtgtggac gttctgttcg     42240
     ccggtatctc agtttcctgg cggcacagac acgatgtgca tagtccacat ccaggatgac     42300
     gatcgtgttc ttttaggcgg gtacggaagc ggtgctagcg tcaagcggcc tgtggcaaaa     42360
     ggtcagcctc taatatagga agaataaaag tacttcatac gtatccccga gcgtgccgtt     42420
     tgagctggtt tatcgctgtc gccaggctgg ctagggtcgg ccgctagaaa tgtttggaaa     42480
     catttgccaa tgttcctttg ggcagaggta ttgtctggca gggtcgaccg tgaaccgcta     42540
     tcgaccggcg agcgccgcac gtcgcctggt cgcttttgtt tgcctgaaca tccgggaaca     42600
     tcggcgccag tgcgacgctg cttccgcaga atatggtact ttttccctcg taaagactca     42660
     acgcctcgat ccacctgata ttcgtcataa tatgcgtcgg agagggcttt ccacgacagg     42720
     tcccaatggg catccagcca agagagaaga cttttctcct cccattctgg ccagccgcat     42780
     gcgctacgtg gggacatggt gatgcttggg caagtcacag aagtggtaag aaagggtgaa     42840
     gaaaacagcg gaaagtgaat tcgaagacga aggactgttg agtttaaggg atcatagcgt     42900
     tgtacgtaaa aatgactatg cgtttatgag ccatggctca gcttggtgaa ctggtaccag     42960
     actctcacga ctcgccccag ctcaagttcc tgaagaccaa aagccttcaa cttttggtgt     43020
     actgtgtttc gttgagaatc aacgacgtcg aacagccacg ggagcctgga cttgttgaca     43080
     atatcccatg gtttcaccag ttcgttgaaa tacgttggtc cgactcttag tgagtcgttt     43140
     tccgaaacgt gcagtatttg aaatagatat ctacgtgcag aaagaatggg tgaaaaatgc     43200
     gtgcgcttgc aattccccct atctcgggca caacactcaa ttttggtccc gcgattcaac     43260
     ttgctataag gccggagggc tttctcctat cactctcaac cagaagtggg aacactcgtc     43320
     acctcaacgt aactcagacg caggcatggg cggaatgcgg aaagtctcgt gccctcttcg     43380
     acgaccaaac tttcgaaaca gattgcaacg tgcattgtct ttgtcgtcct tagagtctga     43440
     ggataccggc agtgtgtcca gctccgctac agggaataca acaggggaag agtcaccttc     43500
     acaggaggaa aacgactccg gcgaccagga agatagtgac gcagctgatg agagtgagca     43560
     agaagctgca cgacagaaga gaactgtgtt tggacatgaa acggactcgg aaatacgcgg     43620
     gcaaactcag ctatccggaa acagcaatac ggttgctctt gaatgcctga cggagttaat     43680
     acaattccac gcggacataa tctagaagtg gcctgctaac aatatccaga ttagataacc     43740
     gaatggggtc agttgtggtc gatactgagt gagaatgtaa agcactaacc gtctccgcag     43800
     gtctattgag cgctcatcgc atgaccaagt cacctggaat gaaaccgttc gcaaggatct     43860
     ggccgacatc tttgatcgat tagcaatcgt cgagactgag gtgcagaagg tgatcaggca     43920
     gggtacaaac aaaactacag agggccagaa gaccgggcga tccctgcgtc ggcagcagtg     43980
     atgcgaccga aactgtagtt tgatatccga ccatgtacac cacagcaagg catgaatccg     44040
     tgttggtctt gagttgtgga tacgattgtt tcaaccgact gaaaatatta ctgaatatgg     44100
     acactcatca ttgatctggc attctcaaat ggcatacaaa cgctcttcca tgacagcgcc     44160
     aaactaaaag caaacgatgc tcctggccct gccgagtggc ctggcatgga atttcatcaa     44220
     agccatgggg gcctagttat ttatcaggcg tcgcctcact cggtgcaaaa gcacgaaggc     44280
     ggctgtgatg gtcactatca tgggcaacca ggctgctcga ttgatccagg ttcaatttat     44340
     tgcggatcac gacctctgat ctgttcgctc ggatatctgc ctacgtcggt gccatccaac     44400
     cacctcctgc cagggccacc tcctgagtat tttgactatg cgccgagttt ctttggagct     44460
     tgccttttct caaaccaagc gaacatcaat tctccctacc cacggccgct tgaggcactg     44520
     cgccgcgaca gccagaatac tgttgcgaga ccctgccaag cgtttgggca gcctgtcaat     44580
     cttctacata gctcgcagga tccgtccaat ttgagcatcg gaggtgccca aaccaacatc     44640
     actcgacggc cgttcaaatg cggcgttcag ggatgcaaga gtcatttcaa acttcaaaag     44700
     acccttaacc gtcacctggc aagccattca ggggagaggc ctcatgtctg ctgggtacct     44760
     gggtgtcagc gcagcttctt gcgtcgggac aacctaaaag cacactatac aacgcacggg     44820
     aaacgtaagg gccgcaatcg ctatgtggct accctggata ggacagcatc tgtctataat     44880
     cctgaantct gtgggcagct aacgccggaa ggatggccac tagattactc tggccaaaat     44940
     tgatcctggc gatcgagatg tacgatggca ctgaagtgtc aacttgcctg ctatcaagca     45000
     cgagaagcaa cgggatagac ttttgaatac agttggaatt tgttctctct anggctgttc     45060
     tttttcgtgt tanctaacct acaaatcccc aaccacagcc ttgtaaccct ccatccgatt     45120
     ttctacaaac cgatttgata tgagatacat tcagatgagc agagccgata cggaaaacgt     45180
     tcaccaagat caaagctatt cgcattnttt agtaatggca atgccatatt agatttcaag     45240
     gagaccgagg ccaacgaggt ccagggactc ggacaaagaa tatatgtagg ttaaacgacg     45300
     atacccaaca gctgggctac gacaaagcca gcaatgtaat tgtggctaga gaccacccac     45360
     ttttggttgt tatcgtgtca tatctaccag ccacaaatag ctttctgcga atggcgggcc     45420
     tagtgaccag ttggagagat ccctagtgtg cnaaaagana ggttttacga gtaggttgtc     45480
     tgatttcccg atctggtctc catctaaaag tatagaggag cgttgtaaag tcaattcacc     45540
     gataggccac aacttcaagg gatataccaa ctttcaggtg gatagtccta gggtgttgta     45600
     ncaaaccggt ccagcgtggg cgaccagggg anacagttca ttgtacagat ttgatgcact     45660
     tggagctata ccacagacgg cttacgccac aaagaagcta gacgtagttc ttccgcgcgg     45720
     ggtaatactc ctcaagacat gaggagcaat gggttatata gcagcgcaac aagctctagc     45780
     aattataata tactggaagt gtacgttagg atcagcgagc cctcttagga ccggtagcag     45840
     gcaagatatt cttttcgggc taagtggtga acagccgctc gggcatagtg gcctagttag     45900
     cgtgtgtcgg gccgttcttt tcactagact ttcctatcga tcgtgacaga gttctgtcca     45960
     gtgtacatat tggcccgctg tttcggatgg gaatacgggg tgcagatgtg tcccagtcgg     46020
     atggtatata catttgaggg ttacgtgatt cgtaggtaaa gtcagcatca ggcaagaggt     46080
     atgtaggctc tctaaagtca actgctctac actttctggc ccacctgcac tttctggcct     46140
     tgccgagagc gacatcatat ccgcggctgc tttcaaccct gggcgaagct cagctattct     46200
     ccgattggat ctgctcgtgg tgccagagaa cagcctggat gccaacggga aaattttggt     46260
     tcacagtaat tccagtctgt ctccggacac gcgggccgtt catggtttag cgtatcgggg     46320
     atattggaat ttgctccggc tacgcactag cgacaagcta tctttctcag tttcaaccaa     46380
     acgatgaaca gcccaaaacc tcgcctttac ttcctgccgg tatcgtatcg ggtaatgcgg     46440
     gtagtaggag cttctcaatg catttggtta gtacccacaa actctgaaat tgttcgaata     46500
     tggcagtgct gcggcagatc ccgaccgttt ttatcaccat cagcacctaa aaattggcca     46560
     ggcctcacgg actttgcccc cacgctggag ccatggatcg tcgatcgcac tatggagatc     46620
     ggaaagtaaa gagctccctg cccattccct cggccggctt gctcatggaa agcctcacgt     46680
     tcttgctctg ctacctaaat tttttggcta gtcaatctac tcggccatgc tcatgatatg     46740
     cttccaccta tgtggtgttg cctgtaccag atccccagtc catgaaggag atggtagccg     46800
     aaaatagagc aagcactgaa tctcaggggt aacatcaagg ggtcggtcgg ccctacgcgc     46860
     caatccagat cagcctcaat atccctctgt cctatcgtca tttcgcattt ctatttgtct     46920
     ttaaatcctt caagaacctt cagctcgtaa aaacctcttt attagattag tagggtattg     46980
     aaaccccagg taggtgttgg gttttactcg tgtaagatgc ttaaaaacgg cggacatggg     47040
     tagtgtcgaa acatggcggg ccaaattagt aacttcttgt atccacggat attaaatcga     47100
     accctattat taccccttcc agagtgttgg tggaaattaa ttatttgggt acgcgggccg     47160
     tcgacgattt aggcatcgcg ggtatatcgg aatgtaccct ccaacgacaa agaatctgcc     47220
     tttgctgttt atcgtacgac gttatcctct acgtctggta ccaggtatcg tcgtattgta     47280
     gaagtttccc aatcctgcta ggattttctg aatcctgaat tttgatatca agtccaaaaa     47340
     tgacaatgct ccggcagacc ccgaccattt tggtcaccaa cagcgcctaa aagctggcaa     47400
     ggatagctga accgctcctt ttaccccgtg accttgttga tccctcatgt tctttgaaag     47460
     tctcttccaa atccctcaca tcagtctgac acggaactcg ttatttgaat attcagattg     47520
     ctcggtcgca gttgggactt gtgtgtgtgt gtcatgcgcg ctaaaggaga ggacccaatt     47580
     tcaggggtaa acaatgaggg gtccaccacg agcggactgt ccggcgccgg agacaacacg     47640
     gaccaacagg agtacaagga aaactaccct tttttttagt tttctgttgt tgtccagatc     47700
     ctttagtgag ccgtcaaagc ttcttgggtg ggactggtag ggttcagtcg tatggaatca     47760
     acaacagtac ataggacggg gaaggatcaa atgttgtggg tcggtcgaga tccccatttg     47820
     ctaataatgc cactgatgga tggtctaggc catgaatcct ggttgcgccc aattatcagg     47880
     cttgtatgac cacgcgggct ttcgttcttt gtcgaacgtg gcccccggaa cctgcagcaa     47940
     gaattgtcgc agggtttgtc gtaccctgtg ccgcaaaata tcgtagtcga tctcgtcatt     48000
     tgctttccac tggccgaata gacgtcgagg gctcactggc caaacctaca aacatgccag     48060
     caaagagtca gataggcttg gggcagaatt ccgagttcag ctcagaaact attgcgggcc     48120
     cacgcgaagc atcggcctct aatgcatggc tgccttcaac cactcggagg ctgagatggc     48180
     gatccaaccg gacgttgccc acaatgccaa gtctagtaat gttagtcgga gatcttcccc     48240
     aaacctcggc ttcgttgaat tcgccccctc agcctaggtg agcttaggcc cccgctggtc     48300
     ttcccacact acgtcgccct ggtcttcaaa agtactgtag ctaattaaat tacacacgaa     48360
     atgccagact aggttgtttt aacaaccttt cgatttcggt caattatttg ggccagtagg     48420
     aaaacaacct tccccctcct attctcatgc attccgtgca ataactatct ctccgccctc     48480
     acgcacttgg gtgccatacg ctcacccata tctacccacc aagccggaac aagcccgcag     48540
     attggcttat tttctctaaa tggtgtctct tcctaggaca gatcctctag agacagcacc     48600
     gcctcctaga acagcaccgc ttccaagaac atcactgccg ccaagaacag cccactgccc     48660
     acctggggtt tctttgccca aatattgctg gatttgttgc cggcctatag agctctcaaa     48720
     ttacgcaccc gacacttgga aaagcgtatt ccagcctctc cacatttctg gagacaaagg     48780
     ccatcttgta ccggtccgac gtcactcttt aacggagcaa ccagccgtgc atgcttgctg     48840
     ttggaaagtt gcggaattgg tacttggacg ctccagcttc gatccgcaat tactgaatac     48900
     gattgcaaac caccttttca acctgaggct tttcgctaaa ccaacgccct acaactgcga     48960
     aacgaatggg ctggactatg ccctgtttgc agaaccggat gccctttcag agaccgccga     49020
     tgaggatata tgtcgagaca atttttcacc agaatttttc caacaatgtt tcgcactact     49080
     tgatcagcaa ccgaatgtca ttacaataga ccaagttgaa cgagtcgatc cttgtctagc     49140
     ttgttggatc tccgaatgga accagtatga cctgcaaaac gacaagaacc tgaacatcag     49200
     atcctgtgtt caaaggatag ttaagaacat taaagagtgt gaccaatcca ggtttcccga     49260
     gacgtacaac ttccgtgtcg catggagtaa tgtacacgaa gccgtcaatg ccatgaacaa     49320
     ttccccgctg ccaatctttg tcgcaaatga cccacaactg cctgccagcc catatggcag     49380
     aaaacaatgc ataccggcaa agacttgtcg ccgattggag tttatatttt caagctatgt     49440
     atcatcaccc tgcctgtcag gcattgctta tgatggcaag ttgctgggct ttaagctccg     49500
     atcatccaaa tcataccatg tgcgcatcaa tgatctgaag ggtttagtac tcggtcgaaa     49560
     ttcagtgggc agcatcacag ccataaaggt caaaaatgga gagaattgga gccagtggta     49620
     tggagagccg caaagtgcct gcagtgatat cgaactggaa tgggaaaatc agaacaagat     49680
     gttgattttt catattgatg tgggttcttg aaaccttcta tttttctatg tctgaccttg     49740
     atagatgtta tctcggagaa tttcagacgt cggtgccaaa tagtgtacca cagatcaact     49800
     tgcgtttact gagttgacgg cgaccactga tgtaacctca tccatcgctg gcctggatca     49860
     tgagtacaaa cgggtactgt attttggcag caaaaaggtg catgggttgc tccaaggcgc     49920
     aaagtatatc ggcaaggttc tttctccttt tgtatagtgt tttctgtgtt gtgtgtgtgc     49980
     cccggagcga gttccggagt gaaatggctt acaggttgag tccgagctca tcccaggaaa     50040
     atgttactag ttgtaacgag gaaaaatggg gcgacaacta attccaatta ttccgagctt     50100
     gctccaacct tccaatccct tgactattta tcacgcttca gttacctttc cttccatttt     50160
     aaccatagtc ctgatgtagt atgttgacga tcttggcttt tatgcttccc agttaaaacc     50220
     agggtgtttg ttttctaaag ctcgggaacc tatgtgagaa cataattgta taccatttag     50280
     agggaaagta ccaaggtgat cagtgaattg aaaatgtaac gaaagctata tgacagtacc     50340
     atttactcag cgaaacggtc agtcatttgc acagagaaaa agcatgggac tcggaccgtt     50400
     agtcgagaaa gcggagcccg cgtcgaaggg atgtagaagg cttttccaac tctgtctgct     50460
     ttacagggcc aaattttgtc ccaactcctc tttgatcagg tacaaacgca tgatccctca     50520
     gcgctaatca agtatgggtt agaaggaggg cccgtaattt catcatccga ttcacaacct     50580
     ggacgcttct atcctcaacg ccggcgaatc tttcaaaggt taaccgttgg ccattctgtc     50640
     ccattcaata tcacggggta tggcagattc aatgtagcct gaccagaaca cattcgatct     50700
     gaaaggtaca ttggatccat atcgaaaatg tgaggtgaga gaaacgattc acagtaaaag     50760
     ctgttgtagt tcaaaagaat attgattgat attgtaccag agagaataaa agaggctata     50820
     tatacgagaa gatcaagttg attttgaaga cccacttcgt tcttcatata ggtgcaggaa     50880
     ttaattctcc tgggtcggcc tggtccctga tctgcaccag cctcatatat cacaggtaaa     50940
     gcttcttcgg aagggcccga acaagtgcgg tcactaaacc tattttcaag cacccagcgc     51000
     atctttacca tgactctgac tgtagacgat attttgaata cagttcaggt ctcttacaat     51060
     atcctatacc tcaaaaggcc tccagaaggg gttatatgaa tagtacataa aatctatatc     51120
     aacggtgacg gagcgtggtg gcgccagtca cgacatgtaa aaccggatca aggaacgctt     51180
     cgtttccgcc caagggccat caggaaccat ttcatgaggg aactttccat tatgagctat     51240
     ggcgtatcga tcagccccgg cctttaacaa ctcgcccgct gcttcccacg tctcttcttt     51300
     ggcgacgatc ctatgcaatg gcgtgaatcc aagcatatcc cgagagttca catcggcccc     51360
     gtactgaatg agaagtttga caatcttgtg gacattccat gcttcggcag cataatgcag     51420
     aggggatttg ccattctcgt ctctcgagtt gacacagctt ccgtgttcga gtagaatctt     51480
     tgttgactca atagatccca tacgcacagc aagggaaagt ggcgtcagtc catccatgtt     51540
     gcgaaattga acatcagccc caagcgacag aagggtttgg atacattcca taccttgtcg     51600
     ggcataaaat ctccggatag cgttgaaaat tggagtttca ctatgcttgc cgccgaccca     51660
     attaacatcc gcgccggttt cgacaagcca gcccaacaga ctggaacacc aactcgatga     51720
     cgaagcagct agatggagtg cagtttctcc gttggcatct ctagccataa tactggcacc     51780
     acattcaaca agagcttgcg cctgtttaat ggcgctctgc gagatcgcat ggagtagagg     51840
     cgtcttctga gcgtggtttc tagcttcgat ctcagcccca tgtaggaata gagttcgaat     51900
     gatgcttttt ctgccattcc ggtgaatgct gggatttgtc gcagcgtaga agagtgcgct     51960
     ccaccctttc cagtattgat tattgttttt gaagttcgga ttagcgccaa ggtttaatag     52020
     caggcgcaca gcacgggtgc atgaatgatc agctgctact tggagtggcg ttcttcccat     52080
     gttgtcttga gactccactt gaataccgga gcctatgagg atgtttataa tcccgggagt     52140
     agcgttcttg gatgccgcga tgtgtacgag ggtcatccca gttcgactgt ccaagatgtg     52200
     tgtatctgcc ccatgcttca aaagcaatac cactttggat tcctggtttg accggacagc     52260
     ctccagtaat ggagcatgtt tgtcaagcac aacggaattg gcaacggcac cgtgttctaa     52320
     gagcaacttg gtgatcgcca cgtcgctacg accctttgtc gccaaaacca agggtcttct     52380
     tgatcgggca tctgccatat caggcaaagc cccgttctct agaaggatct gtaaaacgct     52440
     ggtacgcttg gtagaaactg cttccagtag agctgtcgac tgcgcccgat ccggtgatcg     52500
     aagattaaca ttcgcacctg tacgcagcat attccgcact cccacttcgt ccccgcggct     52560
     tgcgtaccac aaaagggctg atccaccatc ggagcgaaca ttattttggt agagctcatt     52620
     ggtcaggaga tggtagaact tttggctagt tcggagaaag ctggaaaggt cttttggcga     52680
     gttcaaatga cttgaaatga gcaaagtcaa ttccggtgga agagaggaaa gagacattgc     52740
     gagattattg gaaaaatggc tgatctccca gtcaatagag tgaaggaatc tttcaggttt     52800
     tgcttgagct aaacgggcca aatgcggttg gccgttgtgt accaggcgat aggaaagcta     52860
     gatcagaata aagggagacg agaattcagc caacccttgt tctatatgta acaagagcag     52920
     ctaggtcgcc gcctctggtc caactggttc gaccaggtgg tgttggggcg ttgaaaaggt     52980
     agccgtagta atggttatcc caattgaacg cttccaataa tctcttccac taaagccaag     53040
     actcaaggct ttataagact ttagtgtcgt caagcccgtt taacatcttg ttttcttatg     53100
     cactgctgaa gtagaactta atttttctgg gtgtatttga atatttgtag gcaacaggga     53160
     tatctttttt gaatagcgag gcagcctgag aacaaagaat aatggttgtt ttatccgata     53220
     ttatgacttt tgatgtgagt aatggctggg cgccttgggt gatcgcgttg aagcgctagc     53280
     aatatcaacg tttattatag gcagatttgg gctacgttca aacttctaat atttaggcag     53340
     cgaataggga tgtcaagaac tcccatggct gctttaaatc cgagcttcta ctttctgcca     53400
     ggctcctcag agattgtatt gcgatcacag gcaatctcac cttctggtta atgaaggttg     53460
     aagtgcttca acgggcgctc atattgtttg gaagagtttg tgggcgacag tcacgctcga     53520
     ttgtacccgt agttggtttg ttttccaagg taccacccct tggttccaat agaagcaacc     53580
     atgttcatgc catagccacg cactgctcaa atgctacttc tttcctgtag ttgcccgcag     53640
     ccaactaacg ttgccttcaa tggaatttat gttacctggc gtcacagaga cgatcaggat     53700
     actcccaatc caggatgatt gtcctttttt ttgcagagag tagataaaat gtttacacct     53760
     cgttgtaaag tcaacgacag gaacccaacc ccagtcccca ggacaaccat gcgagccagt     53820
     tgatctacca agagtcagga tcgggcccct cgtcgatcgc caaccacctc gcgagatggc     53880
     aacgctacta tcacactctg ctggtaccct gggtcgcagg tagacaatat ttccatggat     53940
     cgcgtaattc ttcgcagtaa ttcgctcaca gcacagggaa acttttctgt aaaactttag     54000
     ttccattaat attccagttc ctctcccacc caacagaccc atggtcttct caatttttcc     54060
     agtatggcac gcccaaggcg tccaagtcgg aaccagcaac aaagcagaat tcatgttcag     54120
     gtgccaaacc tgctgaaggg ccaagttctg accgtcaagg attttccgcc cccgggccga     54180
     tcgcgtgaaa cgcgatccca ttcaattatc tctatgcaga ggtacaggga tgatacagct     54240
     actaacgaac aaggtcagcc tgagactagc actgtttttt ccacaacaag tcagaacgtg     54300
     gccggaggca cttcgaccag atcttcctgg cgatcgcagc ctgcgagtaa gcggtgggca     54360
     atcacgacta gtctttccaa tttggaatct gtttctaaca gactgctctc agatcagtaa     54420
     aaaggttggt tgaacgttat cgagggaaga ttgataccat cttcagtaag ttaaagctac     54480
     aaattgagga acacgccgac taacctacgg ccacgaacaa cagtcctcca aggcctatac     54540
     tcacttctcg gagttccgat gacaagcatc cctttccgcg cacaaaatct tattctccaa     54600
     gccatacagc gacatctaga attcgattcc aattcgttca taaatggctc ttggaggagt     54660
     ctctcatggt tggatggaca tgcccagagg aactggagct acacaagctt tccaaatgcc     54720
     tggtggaaca tcggacaaga ttaggtgtag ctcttgccgc caagccgcta ttactataca     54780
     aaaatggcaa agattggttt ctggcatccg ccacgctgct gtccaccgtc tttcacagga     54840
     tcgtgaacct cttctccaca tggcccgtgt cgccattgaa ttctctctct gcatcggtgg     54900
     actttcgagc gtacagaagc ttcgccgtct attaaagttc ctggaagata gactcccaaa     54960
     gtcagagcgc cgtcgaacgc agtcaagacg gaacctcaag caccaagctt ctttgccaag     55020
     actgcgcctc gaaggtctga aagaccgatt tctgttgctg ccgaaacaca cccagaaggt     55080
     tcttcatcgg attgaagcaa tgtacaactt ggaagtggaa tggttcctgc aagctgaatt     55140
     aagatgacat ctactcactc gtttcaatct cttgatgtcg gaatacgacg cgacgtgttg     55200
     ttgacgggta tctagcaata cacggatgtt acatgtttcg ctaagtggtc gaaaatactg     55260
     cacttgaatg tggatcgacc attggaatcc tagcggcgga tcaagggaca gcggatcaag     55320
     gagatttgga tttgtagccc agggaagaaa tcagaatgat ctgttagggt ccaacaccta     55380
     ccgcgtgaca ccagcaccgc ttccgtaccg gcctaaaaga acacgggctt catcctggag     55440
     gtgggactat gtgcatcgtg cttgtgcggt caggaaactg agataccagc gaagagagcg     55500
     tacacgttag cagtatttca tcggctggag cgctaaactg cgaggtcgaa ggaacagtgg     55560
     ccaactattt cgatgaaata gtcctggtgt atgttattac cataagaggc agtgattact     55620
     cgacaataga tccctcagca tgagagatat gtatcactcc atggagttca tataagatgg     55680
     agcaatcacc cttatttgga attacaacaa tagtgaggaa gaccgaaaga caaaggtgaa     55740
     cattcgagca tgatcgtggt gcctctgaac aggcccggct acacagtttc accctgtcat     55800
     tctaaaccag gggcatgacc catgcggcct gcaaaatact gcgtacaggg taaaaggatt     55860
     cacggtacta tgatttttcc cataggcaga taggacaggg tagcaagggg aatctgggaa     55920
     actgaaaata tctgggttct aaattagccc aaggaaatat gtggatttaa ttggattggt     55980
     tgtcgaaaga ggggtgatct ttggagtgaa gcgtccgatt tgcttttgac ccacgcccag     56040
     aatcacaagg aaatcaagtt tgacaccctg gaaccacgag cgggactgcc gatcagtagc     56100
     ggcaccgcaa atcaattcga gagcttgttt gggtgaacca tggaaatgct cgctcggtga     56160
     gaaaatgcgg ctgtaatgaa ggattcaagc ctgggatttt tcccaccttc tttccgggct     56220
     gctcgtgatt aagccttgca gcccaaaaat gggaactaga aaagaatcac tacaatctcc     56280
     gtcggccggt atgtaggata aatttactgc ggtaaggcca atattttatt agaaagttcc     56340
     tttaaattca tcatcttgat caagaggcgc agattgattg aaataaagtt tagggccgca     56400
     ggagggccgg tccacattaa aatattgtcc gggggccaat cggttttagt aaaacggagg     56460
     cattttattt aagctcatgt ggtttgtcca taattggcat agttctttac aagccgtctg     56520
     ctagagttat tgaaatagcg gtagacttgg agagaaggag aggaagtgtt gttatggccc     56580
     aaagagagca ataataatcg gggaaaggct tattgcagga gaagatacat agcttctaga     56640
     acgttctaca caccagattg acaaatagca ccttgccact tgatagggga acttacttgc     56700
     tcgttactgc gaccaagtga acacaaccac ggtcggggtg tagccttcca ctctatcgcc     56760
     aaaatctgct gttattccaa atactcacct gcccccagca gtacctccta ggcaacaaac     56820
     ccccgttcca tcggacactg atggccgaaa actttgggct tgtggatcgc gtctggacct     56880
     ctgcaattct ttccagtttc tctccgggcc acaaatagaa cctccctgat ctactgtccc     56940
     gtgggtcgtc gctgagatct gcatcgcaga accgtacctg cgtctgtcta aattcacgcg     57000
     tggtgtttga ttggccggtc gggtgctatt cgtctccagg gtctcatcag tgtgatagta     57060
     gcgttgcaat cttgcgaggg ggtggcgatc acgagaacct agctcgtagg ccgtggatgc     57120
     atcagttcac atggttgtcc tggaaactag acccagtttc ttgtgagttt ttcaaagggt     57180
     ccggaccttt tttggctatc atgccctccc aaagacaatc ttcatcctga gtttaaaagt     57240
     atgccagtgc ctatgcgccc agtagagatt ttagtaaagg cacctaagtt ggctgcgagt     57300
     agaaaggaaa gaaataacat ttagcggcgc gagcctagag atagcagtat taattctagt     57360
     gagaccgaaa ggtcctctgg ccaaccgcag gtacagcaca gcgtttccgt cggccatctc     57420
     cagcccatta tttcggcatc tgtcgaagca cttcaaccct cacgaaagaa acggtgaccg     57480
     tagttaaaac ggggagacgt agaatacaag cgcgttgagc gatttaattg caaattcgat     57540
     gatatgtacg aatcatactt ttgcggcatt actttcttct caacagtcga tgaaagtggt     57600
     tcaccacact caacgcacaa ttttgagagg aattattcca ggtcgagact tggctctgta     57660
     ggccacaaag tctccaaaca ccccttcaac gtcgttcaaa tcgcttcaac gcttattaac     57720
     gagacagtga ttctcgctac catctgcgca actggttcct tggtagagac gtagccgaaa     57780
     aaatataaaa ggagccggat tcccagccca aaaacaatca ggacttcggt tctcacactc     57840
     cggtgtgtca tggtgcccct ttcttgcctg cgggcttgag agtctccgtg accacggctg     57900
     tcgctgccac gagcccagcg atgtaagact tgcgctccct cgctgccacg agccccgcga     57960
     gtgtaaaaag gtgcttcgca ggataggtct gcgtcaacaa caatcctcgc aggataggtc     58020
     tgcatcatca atatgcctcg caggggggtg ctgcgtcaac aagactaccg caggataggt     58080
     ctgcgtgatc aatatgcctc gcaggggggt gctgcgaaaa caagactacc ccgcaggata     58140
     ggtctgcgtg atcaatatgc ctcgcagggg ggtgctgcga aaacaagact acctcgcagg     58200
     ggggcgctgc gttaccaagt gaactccgca aggggacgct gcgatgacaa gtgagacccg     58260
     caggagaccg ctgcgttaac aagttctctg caggagaccg ctgcattacc aagttctctg     58320
     caggagaccg ctgcattaac aagttctctg caggagaccg ctgcattacc aagttctccg     58380
     cagctaggcc ctgcgtcaaa aaagcgcctc gcagggacat ctgcgacaac aagagcctct     58440
     agcacgtgca ggcacctctt cgtggtgcta gggaccagta ttcgagtgtt ccaagagtat     58500
     tcggagaagc aaagacctgc gcaacatctt catcgtctgt tcattgttcc aaagggtcat     58560
     cattggatac atagaaggag ccctagtcag agatctttgc caattcaaca gccaaaatca     58620
     taaactaaca actcaagcgt cttcattatc aaaggacgta tttcccattc ctttcccttg     58680
     gtagcttgtg atccaatagc ttcctcgcta caatagaaat tggcatcttt cattcagatt     58740
     aggcaagcag agatgagtgt tgtcttggaa tgcttgtggt gtttaaccgt tggtgttgaa     58800
     ccgttggtgt tgatgtgagt gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg     58860
     atgtgagtgt tgatgtgagt gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg     58920
     atgtgagtgt tgatgtgagt gttgatgtga gtgttgatgt gtgtggtgat tgagcgtggt     58980
     ggtgaatggt cgggcggtga aaaaggtggt caacgtcaag accttgccat cggtccatgc     59040
     cagccctcag attatgtaag tttcctgaat agggggttca actccaactt ccggattaat     59100
     cggttattta cgtctgtcac cctcacctac cgccataacc actggtatag taggtaatcg     59160
     atcctaataa cggtgtaccc tgttatataa tttattatat atattacctt tatgaaaatt     59220
     ttattggtga gactagtaga cagtatgatg tgagtggatt tgtaggttca gcgatttttg     59280
     tggtcagata tatatttaca cacattgtac tcgcatcact atttctattt attttagttc     59340
     gcactcccaa gtttcattca gaccagaccc aacagtccac cgctttgaca acttggttca     59400
     atccatctcg tccgctatat atccttctac ccaactaatc cgaatacgta gtattgtggg     59460
     acctgtacgt ggttaaaaca ctgtaacgta aatgcgtgcg tgaagggctt gttaacaagc     59520
     ggcccatggg ccaaccaacg ccatgcccgc ccataggcag gtggaagtaa ctaattgcga     59580
     atccatgggc ctcatgggcc gtgtcgaggt cgatcaatat ccccagacgt agcacggagg     59640
     ttttcttgtc atctcatcca catgatagat gtatcaatta ttgatcctat ctcgcaagcc     59700
     atctctagtg ccattctgat cactcggtga atttgcatac agcccctact tcgattgagc     59760
     tggtcgaatg cacaccccag actgccctcc gttggttcaa ctatgtatag gcaatacata     59820
     cgctcaagat cagacctacc aggcatagaa gcatttatga ggaaccgctc gaaataccat     59880
     ttgttggctc aactaaacat cgtgatgcga tagactctgc cttcttattc gaagtcatcg     59940
     cttcagtcgg cgattgcaag tcacttaagc ctactctact gtaggatggc tacatcctag     60000
     aaccatcccg agtgtgaaag tggattcgca acaaagaaaa ccaaccaaga atatccgatc     60060
     ggctcctaca ttcgggagtc gccgcaacat tgtaagtaat ccccccgttg gtaactacga     60120
     tttatatcgc cagccgtctc ccatgtatca atatccacta ctgcacccaa accgccgata     60180
     attgctttct ggggcgtagt acccgggttc atgcgatcaa gcatgctctg ctgctgagag     60240
     aacggggtgg tgtagttaca gactaaaact caaattcaca aagcatctgc ttgaacagtg     60300
     gtatgccaaa tgttgtccag ggcgcggtga gtttgacaaa tatatactta atgctgaaag     60360
     gatagtcgac gcatggcgta cagaatccga cgagtccctg gcaggagctg cttgcgcgcg     60420
     ataggttaga aaacgacatc aatagtcaga gacacgcggc cggcttgatg acctgcagtt     60480
     tcagtgacat ccaaggcata tgcgactttc cggatatttc atggggtttg atagaggaat     60540
     gggtgcttgg gatcaaatct accaaacacc tgttccaaag gagacatttc tgacaccgac     60600
     ttgatgcagc tccgtatatc tccacctggt ccgtttccgc tcgttcgtat atgtcgaaca     60660
     cctgagcaat gcggagtagg agacgggacg gtatcggatg gtgttgttta gccctttagc     60720
     tgactgggct gtgcctcggt aacggtcttg tcttctcggt tcgttgctgg tatgaccgaa     60780
     attagcctgt agatcagaaa caaaggggct tttgcctcac gttctccttg cacgcggatt     60840
     tggactaaca acatggccaa cggcgaaggt agggctcccc tgccattaag caagacgaaa     60900
     catcggcatt tcccggcgcc tgtgggatta tcaggcttta aaaaatgccg gatgccatcc     60960
     gagaacaacg tggggccacc cattggacgc cagtaatcta attcacgagg gctattcttt     61020
     cacggtgttc gaatgccgaa agacacggtg gtataagcca ttggaatttg gggtatgtat     61080
     ggcgtagacg catcagcaca tgacctgagg tacagagtag agaagggcga aggtaaaggc     61140
     gatcagaact ttacattggc tcatcaccga tgccaccaat ggtcatgtcg ggatgataga     61200
     gcatgggatc gcatcggtat cggggagccc gagcagacaa tgcacttgcg cggctcgact     61260
     cgagtaacgg gaacataacg gtacccccta tttgtacgat ccgagtcagc aagccttgaa     61320
     ccactaggac gagtggttat gacttaccag ttcataaaga tcgcagaatg tttgcttgga     61380
     acgagacgat caattagctt cgtggtcata ccttaccgac gagatcactt acaattgtct     61440
     tcagcaatgc agtcaccatt catgccatgt tgatatgatg ttgtatccag ttcgtcgcac     61500
     tctccggctg tcacttcgaa gaagccgcgc cggatgcacc gggcaacttc tgagccccaa     61560
     aggcgcgcga tgaacccacc tgtgacaaga tattgtacag tcttaatggg gtaaaacctc     61620
     gcgatacgga cggcgaacac cccaccccac tatcatggtg tgaaggcggt gaggtccaag     61680
     gcggaagacg cgatagagta cgcgttatag tgacctaggt cttatcttcg acccgggata     61740
     aaaggactcc tgggctgctc ccatttacaa tagcataaaa aacagtaatg gttttctgtc     61800
     ttgaggcaga aaagttttca caaataaatg gatatagctt gtagatccgc gagataatcc     61860
     atgactcacg tgttcttgta gccaagacta gggacgaaga gacggcaaag agctgtgact     61920
     attacgctcg tgcattgtag tcgaatgtcc ttggttctat tggaatcgca tcgtcttcag     61980
     gatcagtgag acaggccagg ctaagatcca cacacctggg gcgtggatat tcgagctttc     62040
     tctcgggaat gcacacaggg gctgtacagt agatcagctg agtctactgt tgtggcggag     62100
     acctcttcgc gtagacactt tgaccagcta acccaaaact cgtatctttg atcacctggc     62160
     gtgaatggga gtgcatctgg tggaaatcat atctctcaca ggcactgtct gacttgctgg     62220
     tccatgatgt attctataaa agtcagtaca gcggatctta gtactcgatc aaaggggata     62280
     acctatcgaa tgcctcggac acaagcctgc tcgacttcgc gtagtcaagt gaataaattg     62340
     tagagcaaat tgcaggggca ggggacgtat ttataggctt ctcggctcct tctgttgcgc     62400
     aagtgctttg cttgggagca agcattgaag gacacctatc ctaattgagg cctgttgaaa     62460
     cccatgtctt ctttttaccg caactatttg caggggcatc tttgatgcct ttagaagttc     62520
     agtgagagag acgagtaaga gcggtgttga ggaaaaggga tggtgagttg gtcaagaaac     62580
     gttggctgac tgttgaatcc ttcacggccc tcttaaattt ggactttgtg ggagatattc     62640
     aatccgcaat gacaggccaa tatttcttgt cctaatcacc tcatctgtgc gactcaacga     62700
     aaagcgccta caatttcatc actagaaacc atggacttgt tcttcctagc ctcgcttcag     62760
     tgttgtgttg gttgtgttga gctgtgggtc tctccgtcta gactgcggaa gcgaggtcac     62820
     ggtcggatgt gcgggtgctc gacccgtcaa cccgttgaag cttagctata cgttgtcaac     62880
     actcaatttt cgaacttgtg accatgaaga tacattaaga cttttttttt gttttctttt     62940
     tttaaacttc tttttttggt gactgtaagt tctacaatgt tctgttcact gagttgaaag     63000
     tggaagagat gtctgattga aatatatctc tcctcaatga gcgtttttat ctagccctta     63060
     acatagtgag gcttgattag tttccccacc aacccatttg atcattatcc cttctatcaa     63120
     atttactgct aatcaccaac taaaactaaa aacaaattcc ttcaaagctg tctgcgttca     63180
     ttgaccaacc taactcggtg atcgtaaaac ccagtgcata gttacctacg tctgcatatt     63240
     ctataagaga caccaaggca tgatggaaac agtactgcct atcttgactt tttcctacgg     63300
     gcaaaatgga gtccccaaac agctcgccag accaaggaaa agtacagcag cccagcgaac     63360
     tggcaatcct tagtgatata aacaataatc tggaaccttc cgatcatgtt ccttcattgg     63420
     taagtgaagc acttcggctt caaatgttct tgctaaccat cgcagccctc cacttcacat     63480
     cataaaaaag aaagacatac tttcgcgacc aagccctttc aacccatctt gaaggtgctg     63540
     gtagacctcg aacgcgacga tcacaagttt gcctttccag cagctcgact tgttggactc     63600
     taccgatgcc tatgggagtc gtgtgtgacc aagcacattg atggagagca gctagagcag     63660
     agcaaccagg tcttgaaaga agctggtgcg cacctgagaa aagagaaaga cagccttcag     63720
     cattgccacg acaagcagtt atcccggctg cgcttttttg agcaggcact ggaatcatgt     63780
     cgcgaacgac tgactagtat actcgacgac tggaatcacc cttccaggcc caatctggct     63840
     ggcaccctgg acattgcaaa ataagggtga agtcttgtct attccgtgct gtcctgtttg     63900
     actttactgt aaacacatat actacaattg atatcccaat ccaaaggata tactccatgt     63960
     aaagcaacct ctacagttaa gtccgagtac ttttaataat aagcgtatag gatagtcacc     64020
     ggtctaactt taacatgttc tctaagtgtt ggcgaacaat tccaaatttt agatcaattt     64080
     tatttgtaat atagggacct gtgaattact gtatccggtt agttttgcct ctttgggttt     64140
     agcgcactaa tacgccgtca cgtaacctcc cttcaatgcc ctctgacata aaagacccgt     64200
     cctcgctgct cctcctccct ttctgtcact ttttcattct tcctacctct ctatcttgca     64260
     ctcatcgccg ccccttttct tttactctgg cccccaccga ctactgcaca tttgctttca     64320
     gcccgacgca ctgccccttt catttttacc ggagatgccg cttgatccga catccagctt     64380
     gcaatgcctg tcacccagaa gcgtactggg atgatacagc atcctgttct ttcgtgtcga     64440
     tgatcctact ccttccctag ggtagtgact gagcaccatg ctacgaagat atctaggtct     64500
     ccctctgcca gtgcgccttt tcgtctctga ttccgcgggc cacccctcaa atctgcaaag     64560
     tgccaatata cccttgacgc tgcatccctc ccccgccgcc ccacctgagg ttgcattgca     64620
     cagccccggc ttcatataat ggctcccggt tgcctggccg aacgcccagt tttcgtcatc     64680
     gtcggtctct tcggtcccta tccacccagt cggtgaaaac tcgaaatcac agctcggtca     64740
     tgtgggccaa tagcgaaaat gccgcacacg ccctggacct tggtcgatgc tgcatcttgt     64800
     ggtcaatgcg agactgcaat tgcggaaatt ttcgccagtg aaccatacct tgttgtggac     64860
     tgtgaaactg gcgtgatcta gcgtcctcga ctgcaatggg ttggattgca ggatctggtt     64920
     gagattgtca actcttggta gaagcaggat tccttcttcc gggcctccgt cgtcgtctat     64980
     aaaagagact acaattccac caatattgca aaactggaat tcgaatcacc ttcaaattct     65040
     cctcttcggc tgttccctgt tctctgccag tttctttgtt ttatgagtgc ccgcagtcac     65100
     cacattccaa agtgtcttta gccgttccgg catattatct tcgatgccgt atgccccatc     65160
     tgaggtctga ggttacattt gcacagcccc tgatgtctcc gttgcctcgt cgcgaatccc     65220
     gtggcgccca gttgtcgtca tcgtcggtct ctccggtctc tccgcaccca atcgatgaat     65280
     cttcgaaagc acagtacggc gatatgggcc aatagcaaaa atgcctcgca agcgcctgac     65340
     ctcggtcgac gatgcatcat gcggccaatg ccggaccgcg aatgtggaaa ccgtaccacg     65400
     atcatacctt cacctaccga gtggagaacg ggctggcgac taatgtgggg catgcatcgc     65460
     aaaggtcgtc cgcaaggaag agtagcatta atcgttgccg gtgaactaca acccgtgctt     65520
     gtgaaactgg tgtggtcccg cgtcttggat gcagtggcct ggattgcagg agctggtcga     65580
     gatcttctac gctgggtaga aggcggattc tgcctcacgg gcgaccgtcg tcgatcatga     65640
     ctgccctgac cctgagcata tccaagcaac ggagaatatt attagtatcg taacacatct     65700
     ggacgaatgt ccctcgaatt gctttcgctt cccgaattaa gacctatctg cccaacgcag     65760
     acgacaaaat gcaaaggaga cggcggatca tgatcgccag tcctccgaag taaagaaatg     65820
     ttcacttaca gggaagagac atgcaaacaa ttgttcctgt cggtccacta gagggcctgg     65880
     tcgtggaaag agcgtttcat ttcctgccgt tcgtgcccaa ttctcggccc tttcagttga     65940
     agaccagcta cagttccttt cttggctgtt tgagggtgct ctatcacact gcgtttctac     66000
     gcgtgccaac acagatgccg cctctatatc aagatccatt ccgagtcaag acgtggacat     66060
     ctcctacgac tatccaagct caaacaccga actagatgat acgcaatcta cccctacgag     66120
     gaaaggctta ccgtggtccg cggaagaaag ttatttatcg gtgaagctca gggaagaaca     66180
     gaatctcgcg tggtcagagg tgactaaact ttttgcacag aaattccctg gaagaagcaa     66240
     agggtccata caggtgtact ggagcacgac gctcaagaaa cagcggcgat ctttggcgga     66300
     cgccacgtag aaaatgccat cctaatagat acttagacta ctccttcgtt ttctcttgca     66360
     cctaaaacca caacgtatgt gagcggcgga cttgtgaatt gtctcttcag gttagttttg     66420
     catttttttg gtttagcgcc ccaatacgcc gtctcgttac aataacctcc cttaaaaccc     66480
     gcggctgagt ccggctcgcc tccactgttg cagcccatgt tgggactatc tggccgctac     66540
     gcaggtggcg ccctcgggag aatggccggg ctttggatga agtcttatgg accatatcag     66600
     gtatagctaa tcgacaggtt ggtctgtgca tatagtggat atagtatggt gggttattat     66660
     tggtcaatga ccatgctcgc gttgtttgag aagtttgcaa gacgcctcga ccttggctcg     66720
     agagacaccg acctcctttg tctctagttc ctcgtcgcaa aactaccttc gggcaaatct     66780
     ccaacatgtt gacgagcatt tggaatcacg gtttcgcttt tttctctgtt ctgcgatatc     66840
     atctgtatca tctcgttctc ttcaaagtac cttcgctctt taaaattcgt ctcccaaatc     66900
     atgagaagcc agatgatgtt gagtgctgta gaagccccgt caatggaaaa caacctccag     66960
     atatggcgga cgatacatac gcagcgtcag tcatggaaga accagatgcc ataaacattg     67020
     aaaaagatga cccggtcccg tacgagcctc tcgtcggcga aatcttgggc gaaggctcaa     67080
     cttcccgtat tgcacgcgtg gcgccgggtg tcatcatcaa atatccacga ttctcttggt     67140
     ggaattctaa gacagtggca gataaatggt tcgttcgaga catgaagcgg agttttgagg     67200
     tggaagaacg acttctgcaa atcctaggac tacatccaag aataatagag tccgttagcc     67260
     cctaacttct tgtggacagt gattgacttc ttcctaggtt caagggcgtc tcagatgacc     67320
     catttggatt gttatttgtc gaagcaagcg atggaaatct acagaactac atcgaccagc     67380
     actatgctag cgtcgatatg tccctacgac tcaaatggcg catacaagcc gccgaggcga     67440
     tccaatacat tcatcagaaa ggtgtgatac actctgatct tcggcctgag aactttttat     67500
     tacacactgt cgccggaaac gaactcgatc ttctactctg tgactttggg gggtcaacaa     67560
     atggagaaat agatggccga catctccccg acgccggatt ttttaatcct tgccatccgc     67620
     cggaatcgac gaaaagcacg gacattttca gtctcgggtc catctactat acgataatga     67680
     ctggtcattg gccctacagg tccccaggtc cattcaagtc tctggaggag atggagaaat     67740
     atcaagaact ggttgacgat ctgtttgcct ccaaaaggta cccgccggtt gacggactgg     67800
     cagctggacc tgtgatacaa cgatgctgga caggagaata ctctgatctg ggggcactca     67860
     ttgaagacca gcgttggcag tttgagaatg acacaatttc aatgcactcg taaagcatgc     67920
     ggttatactg agccaaatac aatgctatct gaactagcgt gtcataatca atgctctttc     67980
     aatgccgctt cgagatgagc ccttgaccct ccacatatgg ccactgcgca caaactcctt     68040
     ctcgtaaacc tatctgtcaa ctcaagctcg aattccgatg ctggtcgtgg agctgatcga     68100
     ctatgggttc gggcagtcat atctctcgca tttccccctc tgtctatgtg atgccagtgg     68160
     gttgggaatg cgacctgggc acttaggggt gccaatatcc ttgcaaggta tgaagttcat     68220
     gtcttctctg accctgcaac cgcatgtata aatcttggtc gcgacgttga cttggcacat     68280
     tctaacttgg aagcgtgagc gattggccga tgaattaccg cttgaataac ccaccttggt     68340
     aatttcaaat agtgaatttg tgggcacccg aaagatagac aaatggcatg gagtatagca     68400
     gaagaagttg gttgtcgtac aggctcgaga tcaaagatgt gataattgtt gaatggacgg     68460
     acagaaagac ctacacaagc gacacagagg gaaatagatc attatttgta gacccacgga     68520
     taggcccgac cgtcgacagc acatacattt atcttctcct agaaagcacc atgcatttgc     68580
     tgtagatgtt actcaattcc aatagctggc catacatagt aggcataagc cacacccccc     68640
     acccactctt ggacatttct gggagcttga gcgctcttgg gacccctttt caaaacactt     68700
     gtacgcgtgt cccatagtag attgaatatc actgctcagt tcccctgcat tgcatttccc     68760
     gacttttagg cgatggatat tcgagcttgg tgaacgcgca ttggttgcaa agtttggcca     68820
     gcaaatgcta cgcgcccgcc ccatgcgcgt gacgaggggc aactgcagtc agcctgcatc     68880
     gaagcctgtc gttgggtgct atgatttggg tggacttttg aaaagcccca agaaacaacc     68940
     tatttatagt tctcatcact tacaaaagcc aataaatccc gatgaaaaag cggatttctt     69000
     tgcggttctg ctttgcctaa tcaacaagat ggaaccccac cacaccaacg agcaaccaac     69060
     atcagacctc caaactgtca tcaccggtcg ctttaataat ttcgcttgtg aacttaccgc     69120
     aatgattgaa agcattcaat ttggaaggct tcaattcaca ggtgatgaat acaaggctat     69180
     ggagactgcg agtcgagatc ttgcgaaaat tgcaaacaac atcgcggatg aagtgaaagc     69240
     tttgggaaag agacggaaag ctgctgttgt tgcagaaggg caaaagctgc tttctcaagc     69300
     agagtctgcc aagttgggag tgatggccag ccagaaaccg aaaagtcttg tcctcttcgt     69360
     cagaaacatg cagctgttct tcaacccacc gggggagtca aagctggatt ctccgacagt     69420
     tcaaaaaaga aaacaattga cccgggaacg ctgtgaaaga ctacgaggtc ttgccccgga     69480
     caaaataatt ttgtgggcag cagcatttgc tcccagcatt tgggattcaa atgtacttca     69540
     gaaaagtaca tttgacttcg tcgttgaatt tttggagcct ggcaattcac tatcctggcc     69600
     ccctcacata tacggaattt tgaatacact agttacagag caccctcttt gccaatcgtc     69660
     tggtttcaaa gagtttttga caggtcagta tatcaatcaa cccttgcagg gacggctggc     69720
     agctgacata acctagctgt acaagagagt gttgaagcag gtcaaaaagt cacgggttca     69780
     tgttctcaaa aggcacagac acagcaaact gaggttcccg acgtcgatgg taactgatcc     69840
     tgcaaatttc cttgataaag ggatgctcat actcaaacag aaggtgccca ggaagtcatt     69900
     gaaagagcat ttcttgttcc acctaccaaa ttagacaaac tcttgaagct ccatccccaa     69960
     tcaacagccc gccacagcat tatcctcact atccccattg tcgaccgcgt ggcaacagtt     70020
     ctcatttcta taccgcgaga agatgctatt cgatttggtt gggaatcgtc gttacccgtt     70080
     attttcaacg caagccccca acctactttc gtccaatcaa cctcagctcg actaacattg     70140
     cctcaatttg atgattgacg ggtacaagtc ccatccacat cccggttttc cgaagtgctt     70200
     cccattcgac tgcgcctgtc aacccgtcct tgacccttat acaatcgaag aatttggagg     70260
     ccgccggtgg gcggaataaa atcaaacgct ctgttggcca gccgtcgaag aggcgtaggg     70320
     tataaggcgt ccagctgctg tcaagctcca ttttcgattc atcgaaatcg tttccgaact     70380
     aggagaggaa aaaaggtcag ctcgctttct aaagtaataa agtttcagtg agaacggaca     70440
     tgcttaacag cttccacaga gagtttcatc ttatcgttcg cgatatcttc agatatcggc     70500
     acataggtag ccgccataac cagctgaagt tgacctcctg gttaagcaaa tggtgagttg     70560
     atgccccttc acaaaatcga gatccaagtc attaattcca gagcgaactc acttatgcac     70620
     agtataaaaa tcgctttggc gtgccttctt ctatctttga gacacgtttc gtgctgacac     70680
     ggtggttcct gatggggcgt ttgatcgctg agtcgaaagg gtatcgtagt gggtgggctg     70740
     cactcttctg aaatgtcact ggcactggcc taaatgtttc ctcttattct gagagtgctt     70800
     ccttccatgt cggatctaag ggcgtaaatt aaaacgcagc gtagagaaac aggtataaaa     70860
     gtgaggggtg tctctttaaa acctcatcat gtgactatgt ggggtttgct gcgcccaacg     70920
     ttgcagcgcc caattcctga gtcatgtata gaacgccaaa gtcacagacc caaaacccgc     70980
     caagagcttt gaatagaagc gatatgaatt gacacgatat tatatgtgtt atggcctata     71040
     atacatggtg gcattataca tccgtaattc tgtcttagca tcgtgggctc ttggccatgg     71100
     cgagatctag tcatgtgttt gcttgctagc ttgtccaagc attgcgtatc cataatagca     71160
     cgaggttttg gcaatcactt ctcaataagg ggggagggga agaaaagcgg gaaaaaaacc     71220
     acttgttcaa accacgcaag ttgggcgaat tttcaaatgt gctcgaattt aattgtatta     71280
     agccaaatac tagagccgat cccagattca attgtcatgt tccagtggca gcgattacgg     71340
     ctgtataaat actagccata aattaggtga attcacaata tcacctaact ttaccaagcc     71400
     aatcataagc taatatccct tgagtacaat acccattcgg atctgccatt ttttctttat     71460
     gaaatcgact acaacatggc aatacacacg tacaataaca aatatgcgaa gttgtgatgg     71520
     gcattggaag gcacggatat catatactag gtgttgcttt gcaaagtggc gtggggtaaa     71580
     acgcggttgt atggtcactc aaattagtat aggatcttcg tgaagttatt acatgggtag     71640
     atctggccat gctggatgag agataattgg ggggctaatg tggagatcgc gtccaggttc     71700
     atgcacagta ctgcatgaac taatttacat ggagatgaag acgggatgta atgcccgaaa     71760
     tggagtgaga caggcatgga ttaccacaat ttaaacatat aagaaggcgc aactctcagg     71820
     ctctcgttga ccttttgttt catcatagtc attccagtct tttgcaatac ttcaagaata     71880
     ctactcttca tcgttaaatc gcacaacatg gcatctagaa aggcttctcc tccctgtcat     71940
     tggggcttga cgccgcccaa tagccccacg aatggtttgg ctaggcctca agctaccgtg     72000
     gaggacctga agcagctcta tgaagtcctt gaaaaggtat tgcacaacct tgccaacacg     72060
     caaactgcaa acactcctgt cttccaggat cattcccaac caggcccgga cgtggttcac     72120
     ctgaagcagt tgctggtgaa gctcatcgat gatgagtatt gttcagctga gcccttggcg     72180
     gcggctatgc ctattcagtc ctgttttgcc agcaatgagc agaaagagaa cactgagatt     72240
     gatctcgaaa gtccgatctg taccacaccg gatgatttca agtcgtttga gaaatgggca     72300
     tcaaaatccc aattcaaaac agttatggaa acgtatgagc caccagccaa ccaccccttc     72360
     cactttttca gatagctgac actggtctag ctgggacaaa gaagcatgta gatacaagat     72420
     tgccgagcca acggagacta gcaatgacct ggacgactat actaagtatg catttgttgt     72480
     ccgtgaacgt gttggtacgt aacacctttg cataccggac cgaaaaccta ctaatagtat     72540
     gatcagaccg gacgtccaag gagatagtgt cattcataga catcaagtcg gaaggcctac     72600
     gcgacatcct gcgagacgtg ctgcacgaca tcaaggccgt tagcctgatg gagatcaagc     72660
     catcggtaaa taagacagta ttatcatcaa gaagcacgct gacgtggatt tagatcgagc     72720
     aaaatttcct ttttcatttc ctcccagagc tcgacagatg tgcggagaac atggatagca     72780
     gttcgggcca tgagtcggca catgcggagc atctcctctt gctcatcgac cacctcaagc     72840
     acgcatatgc ttctactttg cagcgtctcg aatcaatgtt gagacacggt catattacat     72900
     atgaccttct ttgggcgctt ttcaagcctg gttgccatgt ttataccaca tgcattggca     72960
     caaaagagcc gcgatgtgtc gtattcgacg cgggcgaaga gatgacacaa aatgacgaga     73020
     cgtggttgaa tctcgagtgc cgatttcttg attataacgg agtcaagttc ggcgaggccg     73080
     gtatctttct gcgagtggcc aagttccgag gatcaaagcc gatcgagagc cttgaggcct     73140
     tccctctctg ccaccatcca agtcacgagc aagtccggaa agatttggtc gagagaggtc     73200
     aaaagtttcg gaatttggcc ggctcacatg ttcggcactg caaaggcagc gcattcttta     73260
     tgaacaaggg caaggctttc aaagtcaaca tcaacagtcg agtggcagta gacgccgcat     73320
     ttttccatga aatgcagcca aattactccc gaccgtcatt ccgcgacatt ggggtcaagg     73380
     ataaggatgg aatttcagtc attgacattg gtgcaatgct catggaggac cgtgagcgag     73440
     agaaggagaa aatgcgagga gacggtgtgg atgcacaaaa gctgagcgag gcggatttac     73500
     tggtctcctg cccaacactt tgctgtttca gtttcaagga gaaaatgttc tgtatgtgac     73560
     acgactgaca atggtttggt gtccggctaa tgtgatccca gtggagtgcg cagttagtgc     73620
     tcttagagac gtggattggt cacctgaatc gctcgattgc ctgcagatag cctccgagac     73680
     caagacactc ctcttgtcat tggcgaaaac ccgcctaggt ctgataccga cggtaccgtt     73740
     cgacgacgtg attgacggta aaggtcaagg gctcaatatg ttgctgaagt atgtcggtga     73800
     attgtacctg ccctgcatag tcttcagctg acacgtgcta gtggtccgcc aggcgtcggg     73860
     aagactttca ccgtcgaggc aacctcggaa tatttcaaac tccctctcta ctcggtatca     73920
     acaattcatt gcgtgcatat tggcttggct gactttctca gatatctgca ggtgagcttg     73980
     ttgtcgatca tggggactcc cacgcacttg aatcacaact tgaaatcatt ttcaaaatcg     74040
     caaagcattt caacgctatt cttcttttgg atgaagccga cgcgttcatg gcaagtcgta     74100
     ccgagctcca tgatagccat aatcgtctgg tcactgtttt tctccgcaag ctagagtatt     74160
     accggggact gcttttcttg acttcgaacc ggggtatcca gtttgatgat gcaatcctga     74220
     gccgaatcca tttgactatt gagtatgaag gtttgacaaa agacttccgc agaggcctct     74280
     ggagaacctt tttgtccaaa gcccgaacac ttcaaggtcc tgccgtggtt gaggaggagg     74340
     acatccagcg attggaatct ttggctctca atggacgaga ggtgagttcc atactattgg     74400
     gtatatatca cttgctgact gccatcaatc agatcaaaaa tatcgcagca gttgcacacg     74460
     ctctcgctga ggcagataca acgcaagtca gctataaata cttggaatta gccgcgaaat     74520
     cgaacaagaa attttccaag gagtttggca ggcagggtcc tgttgacgga atgtatatct     74580
     aacgacatgc atggcaaact tgagcggata attctgctgt caaggttttc agcaacccgg     74640
     accttcaccg cgatatgttc ggtttataca cgacagtctt agctaggtat tgagaacctt     74700
     tgcgatgctt tcataatggt atatcattgg aaaaagcctc aagttcggaa gcccggctcg     74760
     catcatgatt cggtggtgtc gaagcatata tagaagcgca tttcgcctcg aaataatggt     74820
     tgacgacaga aatgtgggta tcaagaataa gatcgctagt ttaacaggta gaaagtggat     74880
     taccttctca cgacaaacga agaagttttg cgtctcctgt ctcagctcga catagtcgtc     74940
     gttttgctgc ccccggtcgc tgcagactcg acatttcaaa gtagagcggt gaaagtcgac     75000
     gatcaaagca cgcccgcttt tcactccaaa ggacattgtc tcgcctaagg tcttcatgta     75060
     ttatcccgag ggctttgatt tccttgttcg atttgtgaat ttaacgctgt actccctccc     75120
     cccaggtatc acgagtgatc tgaaggtgta tacgtaacgt caactgacgc agtggtctat     75180
     gggtctaagg gccgtcatga gcagacagca gttgagctag acaggagctt ttttctgctc     75240
     ttccccaccc cgacgcgatg gccatgccgc atgttgccag aggttggttc aagagcccga     75300
     gggcgcctta accatttcac ttcctccagg tcaatgacaa acaaacgaac actcaggtca     75360
     tcccacagca tattacgcca ctcactgtcg ccatggacaa ctccatgcga ccggagcacg     75420
     gtcagagctt tgtcgcgctc ctggtgaaag aatctggaat tctcatcgtt aatgacatgc     75480
     tgaagccgtt ttccagacca gctcagtatc atcatctgcg ccattaattc accatggtac     75540
     caatatgaga ctcgtggcgt aaatgtccca agacagacgg gaatctgttt tccctgcagg     75600
     ctcctgagag aacgataatt gtctgcctct gctttaatga gatgctgctt gtccaccgtg     75660
     gtagccttga ttatcacagt gtatccgtgt aatagaagag tcgctttgat gaggtaaccc     75720
     gtccgaccac agacgtgaag ttgttcaaac ccatggtttc ggtttcggga aagttgacgg     75780
     tgaagctggc gtgtgaactc ctgcggtccc acggagtgtc tctggccacc gtggagtttc     75840
     cagttggggc attctttatc tagaggatct cggttgacca taccgcggat gcaggcaatg     75900
     gtgcaatatg gtcgcgtaga ttgcccatct ttttgagaag tctgtttatt gttccggccg     75960
     gcttgtgtcc cttcgcttcc tctagctgat tgaagcttgc ctcggccacg gctcgattgg     76020
     ctacgcgagg ctgctgcggc ggatggcgaa tgcgattctt gatcactccc actgccttca     76080
     gtcgacgagt gcttcggtgt agacgcacct ggttgacatt gagcgcgaga gcgggtgttg     76140
     tgtactttcc ggtctcgttt ccagtgcgag ggccgataat tagaggccgg cgggtcttta     76200
     cggagagttt gagggatttc tctcaacacg tctagatatt caaccttcca ggtcgttagc     76260
     ttatcgtgtg ctgcatcgtg ccactcttga ggcggagctt cggcggccag cgcttgaagg     76320
     gtgaacgcaa gcacctggcc gatggcggtc cggtggaggc gcaattcatc gtccgcctgc     76380
     acgtcttgat ttgggataca caagaaatat tgaacaattg tgggatcatc tttcgggata     76440
     tggaggaaaa caaaagcctc ccctgtgcag atgtagccgt accgaacccc actgtccatc     76500
     atgtatgaga atatttgagt gaccacggcg gcgatgaggc gtgtggcata aaattcaaat     76560
     gtgtcgcctt cctgatcgat gacatcgtgg gccagatcta tctggtgtag acccgccacc     76620
     aattcgggga ttgtcatttt gtgcggcgct ttgaactcca ctgcatacac cggtttgtgt     76680
     cgctcgttgg ccacactgtg cacgcagaac tggtcggcgc gccgattgcg ccttcgtgca     76740
     gtgccagcgc tcttctgcct ctgcgccgct cctctccccc ttcctctgcc tctcccatgc     76800
     ctggtgttcg ctggtcgttg aggtgtccgt gcatcctgaa gattcatttg ctccaagctg     76860
     ttctccagtg aagtttcgga tgggttcgag cggtcataga aggtgactcg gccctggatt     76920
     ccaaactctt gtcgaaggca ttcatcatct tgcaatgcct taatgaccat ttcgacaaag     76980
     ttatccaccg tgtctcgctc aaaattccga agagaggctt ccgagtaaat cggccggttc     77040
     tgggtattcg taacgacata atctatttgg gtatcagaag ggaagagggg gcgcgaggtg     77100
     aaggcacccg tgcggtcgag tttcctccag acttgctctt ggagttgagg gaagtcaagc     77160
     caagggacta tgcgcttagg gtaaagtcgg ttcactgggt tggtcgcgtc gccctgagtc     77220
     gtgagagttg catccgtctc aactcggatc gcttgagaca gagagttgtg gcagcggtcg     77280
     agaagggtga acagtgtgtt gggctggaca tgtcgttccg cctcttctcg cgcttgtctt     77340
     tcttcttcct gacgccgctc tgcctcttct cgcgcctgtt tttcttcctc ctggcgccgc     77400
     tccgcctctt ctcgcgcttt tctctcgtct tctcgcgcct gtctctcctc ctcaagctga     77460
     cgccgtagct cggcgattgt tccttccatg ccttgtcgaa agcagtttca tcagacactc     77520
     gattaaaaca aagtcgaggt gaatatagca aggagcctgc cgtctgagac aggggaacaa     77580
     aggggattac gcaccaggat gtttaccagc ttactcaacc tactcacccc gtgactcgca     77640
     ttaatgcctg aggcatccac tcgtttgacc tttcaggcaa actttcagga tggctctgaa     77700
     agtgcggagt tgaatacgga atttgtcttt ctcgcccaaa gccattgaat atagtttggc     77760
     catatagcag aaattatcat ttaatccagc caaatattaa attacgaagg caactgcccg     77820
     ccctaagtag gagtaatggt gaaccaatca tgcgttgcct ttccatgaaa tttctagttt     77880
     gttttgtttg catccaaata gtgtagggga gacgtctcta aaggcttggc cattttcggt     77940
     tttagttcca acattagggc agtcttcacg gagatcgatc taaaatagtc gcgaagaatt     78000
     ttagagccgt cgtgattttc atacttacca gtggttttga tacctaccgg tggttttaag     78060
     acctaccaat agttttgaaa ctgtagtcat ggaacctgcc agtagtttta ttaccgttgt     78120
     ggttttaaaa cctatgtacc agtagataca acggtttcgt agtcgtgcgc cataaaggca     78180
     gcctgacaac aaaaacggca atcaggccac ggcaggcctt gacgaggctt taagttcgtt     78240
     ttcaggaagt gagacatcat acatgaatat acatggatat atatagttgc tgtagcctgc     78300
     atatcgcttc ggcagttgga ttctaaacca caacccacta ggctgagtgc ggattcgtgg     78360
     cgaaatcaac ttcggcgagg ggtcagggta aatgagatct aatactacta ctactagtgt     78420
     accagtagtt cagaaactgt ggtttctttt ggcaattaag tgcgtacgta aggtatggga     78480
     tggctccctt gatacactgt gtcaagacat tccgtaaaac acagcataca aatatggatg     78540
     taaaccaagc aaagctacgg atatggtgtg atgtatatct cgcaacgact gccataacca     78600
     tgatcttccc gaggcactct catatctcag agggaccacg gacaatgttt tgcctagttg     78660
     ggtctagtgg gactctcagc gaaaacgaga gatacgctaa ccatatttgg acacctattt     78720
     ctccagctca tactatgtct gccttgttct ttactgtacc atgaccagat gccacaaatt     78780
     ccctaaatga gatgaagccg aaggttgcgt ttatctatca aaccaagttt gacgatgctc     78840
     ccaggatctg tccgtactgt aggaaaaatg tcgagggaag caaaggagag aaggataata     78900
     aggtcaagtt ctccggtctc gcctgagggc tcggaatgga gcgcaggtgg tccttgcgag     78960
     caggttgaaa tattttattg tcagagacct atgatttgac tcctagaagc gactaagagc     79020
     gtgcctggga gctatagtgg ttcttggatc atcttgtccc tgtagagttc ccccgcacga     79080
     atgttctcac gtatccgtag atgaggacag cgtattccga tgagtaatca atatcaaatg     79140
     aaagctacag tagtagtagt agtagtagta gtagtagtat tcatttacac tggcccctcg     79200
     cctaagttga tttaaccact agaccaaaat acgaatccgt acccagccta gtgggttgtg     79260
     gtttagaatc caactctccc ccgtaaacca taaacgcttg gctgggggcg cgtatgaaag     79320
     ctctgctgcc tggctgtgcg gccaatccta ggccgtcttc tggtggctct gggtgctcaa     79380
     gaacgcaagc tgtgaggatc gaacctatgc gctcagaggt cgcgcaatcc gggctcataa     79440
     ccagttgaaa ccctggattg aggtacaagt gtgataatta gatctagcta tttgtagttg     79500
     cagcagctca tctccctgct gcctagcgga gtgtctgcct aacaggcagc cactcctata     79560
     gatctatata catcacgtga cccgggatcc aactgcctaa gcgatatgca gtactggtga     79620
     cgcgcgctgc gcacgctgtg gccctgaaac gatgaaaagg aacggcagga acaagaagtt     79680
     aaaagtcata ttgtgttgct tgactgatac ttggaatgca agtgaacatt gaccaatcag     79740
     gaggtagaaa gcctttgact aatagccgta acatcttgga aaccaggtgt taatcaacta     79800
     tcgtatttga ctaatagccg taacatcttg gaaaccaggt gttaatcaac tatcgtattt     79860
     cgattgtgca agtatatcgg catatgatgt tttacgtggt cgttgagaac gcctctccgg     79920
     aactggcgtg gtagcccgcg acgaggcttt gatttcttcg ggcgtgtctg gccatgtaat     79980
     ttgcgtcgat tcctcatcgt cgtcaccagg tgcaattatt tgaggggaat cctgggactg     80040
     atgcgtgata ggaagtgatt cagtctgtga ccttgcagcc gatttgctcg gcgtttgtgg     80100
     gccggctctc tgagaccaac ggtccacgcg cttccgttta ccagtagagg aaggagtagc     80160
     gggcaactgg tgatttggtg ctgggagaaa atgtatatca tccgtaacga cagctaactg     80220
     gcgatgttct tttgtgaggc cgaaaacacg accggtcaag aaaacatggg tgtttatact     80280
     cagtggtgga aagttggccc aacgctgacc atctttgaag tacgcggtga cgggaaaggt     80340
     gtgatgggtt cgggttgaac tattgtaaac agtggtttgg aggcggtagt gaagaagagt     80400
     gggcccgccg ttcagttgac caccgcgttc aataacaaca ccgagaaacg tcactattgg     80460
     tgggcagcct cgggacagtg catgaaatac gattcgatat cttctcattg cccggatgac     80520
     tagattgtgt aagcttggtt ctgtagcaga taggacaaac tgaccggtcc aaactgtggg     80580
     cgtggaggac aatatgaaat aattcctcgt catcagatga ggtagtcagg aatgaaccgg     80640
     aggaatagac aaaagtgttt ggtttgtaaa ggtcggactg attaccctca ttaaaaaatc     80700
     tgaccagggt gggaatatca tcctgctcaa catcgtctga ttgaatgtct ttccacggta     80760
     tattgagcga aatacggagc tgcatggaaa gccctttgcc gggccgtgta ggatccggtt     80820
     caacatgctc gacgaagtcc cgaatatgga taatagcggg gaaagttgaa tttgaaggca     80880
     taatattctc tggtgtatat cagacctaga gagaaggagg aggtgaagta tgttcgatca     80940
     gtagggtttc tagcgagggc tcgggagtgc ttgtgtgatg aaaggagaag tgggtaagag     81000
     aaattcgtga ttttgtgtgt agtgtttact atggcgcaag atccctgttg tagatacgaa     81060
     cacaaatatg atatatccta aatgtatctc accgctggtt tgataaagaa acttagtgga     81120
     tgattttagg tttttgcaag ccatctttta tgtatgtaag acgtggagat gtatgaccta     81180
     tgaaggtgtt agataagaga attgttctag aattgttagc ttagggtatc tttccttcgt     81240
     ctaccacaaa gagatgcacg tgtgctgata gaagccagaa gcgataacct cactcataga     81300
     ggaatattaa gctctctgat ttctgacaag aactgtcgga actgttcgtg gcagtctcca     81360
     tctcagacag cgagtgcgct ctcaagggtc tgcagccttt ctatttctga tgagttggtt     81420
     aggcgagaag cagagaaaat taactaggat atgttgacga gatggagata gtggaatgat     81480
     cgcagcctgg gcagttttac gtagagttat cggtactctc ggtgagaatc ccgatgttgc     81540
     cgggcagctg tattatctag gaaatgaaat cgctaatttg aatgcttcca tgcgtccaaa     81600
     gttgcctttt ctagcttttc aagtcttcgc atctctgcga gaatccgggg atcaggtccg     81660
     aattggaggt ccttcatttc gatctcctgc agtagatgga ggcctttacg tgttcgcaac     81720
     ctggacaact gtacgtaggt cgagcagaat ttctggtgac gatctcgacc gcgtatcgcg     81780
     gagtcgtctc taagatccag gatcgcagag tcaagcgtgg agccctgtac tttgtagtcg     81840
     gtaagggaga aagtcgggct tataggaact tgtttccttc ggaccgagta acccttcaga     81900
     gtgatggact tttctaaggg gaagacaggc acagttgctg gagcaaggcc ttcgaaaacc     81960
     gaggtggttg atttgtcctg tttgaataaa acacacgcgg gaggtttggt gcacaggata     82020
     tacaggtcgt caatttcata gaattcggct aaaatcgttt aaagttagat tggtacttta     82080
     gacgcaaggg aggattaact cgcccactgg gtcaaccacc acaccgatag cggttccagt     82140
     cgccccattg acctgtccta accgggtaca aacatttgtc aatatgacac aaggcatgtt     82200
     aggagtgtag agaaacattc cggggaacgg gatcctggta ccgtgatctg gttgctggag     82260
     caagtcgtcg acacgcaagc gaaggttggt gggaccagtg gacttggttc gtgtgtgttg     82320
     agcagggaag gcatagattt tttgacagca agacttggca aagtgttcca ttcgaatacg     82380
     attcacctga tgtcgcagag aattcagctt caccaccgtt gtcgcaccgt gtagctgggg     82440
     ggccaccaag gaagtgatga cgcaggagtt aagcaggtcc aggtcctctt ctgtcaacgt     82500
     tgacgtcctc gctcgatgta gaaggccccg aaatgaggga tccccggact gccgcatctg     82560
     ctcgtctagg atgatcacat ttctgaactg atgccatatg agccggccct cttcgtcctc     82620
     ggcgttgccg cttctgggtt ccttccacaa tgctgggccc cgcacaggtg ggaactggaa     82680
     aaaatcaccc atgaggatga ctatgggcaa agcaccgaag aagtcgcgag atcccctatc     82740
     gagggatctc gccattttgc agtggttgtt gatcacacta agcatgctga gatccatcat     82800
     gctgacttca tcgatgatca taatcgtttt gcgggaccag agttttcaca cacgagcagc     82860
     catcgaatgt cctgtagagc gagtaataga aaccccaaga gatgtgtgaa acgtgttgcc     82920
     gccgatattg tctgccgcgg cgccagtcgg agccatgagg atcacctctt ttttgcggcg     82980
     gatgagatcc attccggcca taatgccttt gacgatttgg ctcttaccca cgcctccttc     83040
     acccccgaca taaagaagtg tctgatgtcg tttcgaagca tcgtacggat gactcgccca     83100
     gtccagcgct tcgcccaaca ccttttcgac gacaaggcgc tgtttagtat tcaatgatac     83160
     tttcactgac aagtaaagtt agagaggtag gcgaggaact gtcctcgaca taggactgct     83220
     ggtcagcgag ggtaggaata acttccggtt cattaagcat aggctccaag atggcatcac     83280
     caatgtccaa actgaagccg tccaggtcat aggcctctcc gaccacacta tgatacacgt     83340
     ctccatgttc accaaacttg gcaagttctt tgagtcgaga ctcccattgc tgtaatgtgg     83400
     atggcgggaa gaagctaagg ccagatgcgc tatacgcagg gctgtcgaaa aggttgagag     83460
     gcagaaggtt ctgcagcggt tgtccctgat tgtgagtcgg tgcgtgtatc agtgaaggga     83520
     tgcgtcgccc agcgaggagc gtttcatggt cccaacactt agcgatggag tgataggctg     83580
     cgatcagagt ctcaacgttg acactttcat ctaggttcgc aaaggagtcg tcagaatctg     83640
     aggcaaaatt gtctatttcg agctcattaa tatcgcggtc gattaagcca ttaactctaa     83700
     ctggcgcttc ctgaagtttc gcatcagcca gactgtcctc cctagacttt cgcaggagct     83760
     caatattcgg agcaaatctt cgaacatggg gcgtgagtgt cggctctata acttcccata     83820
     ttcgggagca ggcatcgcgc tttatcggta cagcgttggc atgttcttga aaaagcgccg     83880
     gtaactggcc ccaaggaaca aataatccga gtaacatctc cgctaagtca ttcatatttg     83940
     cggcagtttt aggatgacct cccggaacgg cgtcttccga ggcttggaat tcagtgagct     84000
     gtccgttaaa ggtgacagtg ctgacctgag atgatgtgtg agccagacgt tgtacatggg     84060
     tattgctttg agggtgtgac aggtcaaagt cgacgtcgtc tgtagtcgca tctcgtacac     84120
     tcttgattcg tacgagcata caatattcga agagcgcgag gcgctcaagc tgcggcccac     84180
     gccatctata gttgtcaaac atgctgacag gggctgttcc gccagcttca taggtgcatg     84240
     gttcttcggc catggggtca gaggattcgc cgacgtcaat gttgacaggt tgaatgagat     84300
     cacggatgta tcgccttagc caccacagat ttatgcggac gaagttatag ttgatcgtgt     84360
     agtgggttgg taagttgagc aaggtgcttg ccacctggac gccgcttatc tcccgaccgt     84420
     gtgagagggt attaaagcag cgaagtgcaa aattgtccaa acccttgtct cgaagtctca     84480
     ggtctgttct tgttggcaat tcagcagcct ctgccctttc gatgcgctgc ttcaacaggg     84540
     cagcctttgc aaccatctgc catggggaga cgtcgtcttt tgtggcataa ttggtgatgt     84600
     aataaatcag ggacaaagac ttggagactg tagggatcca agaaatatca tgattagaac     84660
     gaacgcagct agcaatggcg gggttccagg ggttagtcca cgcatgattc cgtgcgaggt     84720
     gaatcaagcc aaactcgtcc actttggagg tgggaacaag atcccggggc atgccgaacc     84780
     gacaagcatc tttacctggg ccccgttgtc ggtacttgaa gcaggttgaa tgatgatgtc     84840
     tggagtgaat ttgcgtccta cgcgcgacag agttgctgtc atatgacaag cctagaaaga     84900
     actcggcatc ggtttctcgc tccttggctg aaggtggggt gctaggaagg ttcacttctg     84960
     gatcatgcgg gacgctctca tcgatgcctt gcacgatggt cgcttcaagg tagcgaatca     85020
     gacgagcagc aaactcggtg tctccgagaa cgcgattccg caaagtggta aaggcaaggt     85080
     tgcctctgac ccataggacc gcatgcatgt gcaacatccc tcgaccgtta gtctccacaa     85140
     caccataatg attcgaaaga tctccaaggg ctccgatgtg gccagtgtcg gtggcaagga     85200
     ggccgcgcag gattgcttgg cagacgcaat gaaagaaatc agcaacagcc accgggttgg     85260
     aggtggctac agcgtcacgg atcgcggcat ttgttgcgcc gagatcatct acagggaatt     85320
     ccacaccagc cagaattaga acgaggggat tccgtaagtc agagggattg attgtgatcc     85380
     aaaaagcggg cattccatgt cggacaatta accctcgaat ctcagacctc atcctcagct     85440
     tctgggaaaa cgaaccggga acgcgcatgc caatggttac aatgtgttgt tgaagacgtc     85500
     gaatgacagg gtcttcgacg ttttggccag ccttgacatc ttgtgcggct ttttcaagtt     85560
     ggtccactgt caaagaggcg atatcatgcg ccgccgatct ccaatgtcgc ctcttaacca     85620
     gaaaggcatt gcccaatgac gaccttcgga gctgcaagat gtcgaataac aggtacatga     85680
     aagtcttgtg gcgggcgaac ctacagtggt cagcagagac gaagaatact tcatatagtc     85740
     cgtttacctt ctgctgtggt gactcaaagc ccactcagaa agagcactca aggacactgg     85800
     gatggtacgc tcgtctagat ggcctccgac cccctttgga aataaggtgg ggaacgcggc     85860
     ggtaaagtaa tgagggtctg accaatgatc catcaatgca acttggccac gagtcgtata     85920
     agaaattact gggattcttt ggcccgctct agggcatgcc agtgcaggat ccgttctttc     85980
     taaatcttgt tcggatgtac aggatctgcc gccgaccaca tcgagtaagg tgtgcaacat     86040
     gcgtgtgtca gggttctggc gttctccatt gatatcagtg gaaacggaac cagtcaggaa     86100
     gagaccacag tcgttggagt ggaaactttc actttgtgct gcttggagat cattctcgta     86160
     gttaccctgt gctaggctaa ccgtgtaccc ttcacgttcg tgatggtccg gctcgtcgag     86220
     acggataata ttatcccgca gctccaaagg aataaactca tcgccccagt tgtctatcat     86280
     cgagtgatta atggacaatt cccgatacag atgattgttt cgaacgagat attgcaacgc     86340
     ggcgagaact ttgactctgc gaataatcaa aaacggactt aggtccgcat ccgttggtgg     86400
     tcgatcccct aaccagaaaa ccttgatcag gctatccaat ctcaaactcg gacttggtaa     86460
     aatttgaaga agcggacctg ggtcctgtgg aatgacaata aaatgacctc gtagcgcacg     86520
     atggctgatc gaagatcggc ggccgcctgg acgtaatttc acaatgactc ctagagggtg     86580
     gcatcttgca atgacgcact cttcaaccag ggtgagctcg gccaatgcag atgggtagtc     86640
     ctggcaaaga gtcacgttga cgaggttctt tgccgagaac ttaggggcgg ccccacgaat     86700
     aagggctgcg tgacacgacg aacatacgtc ccaggtgctt ccatgctggc cacagcgatc     86760
     gagagcacca cctagaggta agagcaaagg atccccgtca tcaacgggga aaatttcagc     86820
     ttcaggaaca accttaccgc aagagctaca caccgatctt ttggaggcgg ttgaagtggc     86880
     ttcctcgtat ccggaaacgg acctccgtat gtcagtggac gttatctccg gggggaagga     86940
     ctgagaagca gttgcatgac gctcatgctc attacgcaga aagccgagtg ccttgtctaa     87000
     agagtcatcg acattgcgtg gctgtgcgtc tatgatcttt tgccgtttag catggtgccg     87060
     aagaagcggt gcaaggcggc gtgtcgcagt cgaagctggt aaaatgcgtc caggaaaacc     87120
     gtctctcacg ttatcaacgg gctctataga gactccttgg ttctcggtgg tggggagcac     87180
     gcgactacgg gatttatgtg gcagcgcctt ctggcgacag ttatcacacg tcttataccg     87240
     tgcagactgc cacggtcgac agcattgaga gcagaaagta cgcggagaag acgaggggag     87300
     atctgtgtag ggtagcacag attgtgtaga aggagggctt ggcgtatcag cagtcgctag     87360
     cgggcgatga cggcgccagt ggcggtggcc cttctggcga caggcttcgc acgttttata     87420
     caaggactgc tgccaaggtc gcttgcacga cgagcatcgc aagttgggcg cagaagaggt     87480
     cataggtggg cagcagtttg gggaaagtag aaagaaatgt gcagagggaa aataggaaag     87540
     gcgaaatgat actatgcatg gcaaggaaaa tacgaagagt aaaatggaca tcgattaacc     87600
     taccggggta gcacggggct tgcaatacgt ataaagcatg gatggtaatt aacagacata     87660
     atcaatgaga aaccactggt gcaaaggaaa gacccgggga cgagaggaaa gagcgacaag     87720
     gacaagggga aaggagctgg cgaatgacaa gagtgcagca gacagatatc atggtaaagg     87780
     agcaatacgg gaagagccag aaggtcgcaa tagcagaagt gaaggggcag ttgatgcatt     87840
     atgccaggat gatccttgca aggcaagagt acgagagacg cactgtgtag cgtgttacga     87900
     agacaaaacg cacacaagag acaaaacgca cacaaaagac gacagaagca cgtgaacagg     87960
     aatccaacca aacaccaatg aggcagaggc ttggcgctaa agttggctgt gtgtgtcgct     88020
     gtgttgttgg cagcgttaag aagccggggt cgcgcaggcg cgcggtttgt aacccctttc     88080
     actccgttcc ttcgtttcag ggcactatta ctactactgt tactactact gctactctca     88140
     aaaagaacag tattgttcga tacctgcata taagccaggt gggccgtgga aaagtacgat     88200
     tatacgcgtt taatcacagc ctaggatgat gcgcacagcg gaaatggaca cgggagtaca     88260
     cgaaatttgg tagagaatct gctcagagat gaatctaaat aaatccgaac gtaaatgaag     88320
     taaatcacgt gtgggacggg aatcagaaat gatataattg acatttttgg tcgcgtcaat     88380
     ctccgacaat gagatcatcc atatgcatga tgacctcaaa gcaccgtggt cacgaaccaa     88440
     atattttaga attcaacgag ctggctcctg attttctttt tctcatcatg gtttcccaga     88500
     caaactcccg catcgttatg gctgttgctg gcaaaactgc ttcagttgat atctctcccc     88560
     gccgcgctat cctgagtggc ggccatgtgt ctacaccacc cggacagcgt gccatgctgc     88620
     ccacgccacc caactctatt tcgccgaccc tagctcctca ggccttcaag caaggtgtga     88680
     cactgtcacc gggatcaccg ctgtcgacag ttccccagtt gaactccgat atcgatctcc     88740
     aggatgccgt gcaaaacgac aacagccaaa acgtccaacc tgccaacgac ctgggcagca     88800
     cgggcgcgat cacccctgcc atgctggcca aatactatct gcccgatatc atgctcgagc     88860
     agggcccctt ggctatccgc cacatcatgg gtcatctgac aacttcggtc cccggatttt     88920
     ccactattcc cccagctaag gcgcgcagac ttgttattgc ggcgttgaaa ggtcgaggaa     88980
     acggaggaga ggcggatggt atcgaaggcg acgtggtgtg cgagaagatc agttgtggtc     89040
     gttgggacgc gcgtcgccgc ggtgagcctg cgcacgaccg tgatttgaac acgtcggcat     89100
     cgcctccctc gcgccttgcc ggttcgttac agcagcgtgg cctacagatt cagggacaga     89160
     cgggttggca aggtggcagc cgttccccat gccgttcccc ataccgtcag agctttgccg     89220
     agtccacatc cgagacattc tcgtacacca atgactatgg catgcgcagc gaccttgaca     89280
     tgctggaata cggagctgac aagatgtcgc ttgatggcga cgacggcaag tgttgctctt     89340
     cctcggacgc tcccgacgga atgcaagaga atgagtgggc tgaagacgat gacaccgatg     89400
     gggaggactg ggcgaagata ggcgccgatg ccttgcgcgc ccgtgcggta cacaacaacg     89460
     gcggttttac tgacggtcac ttcgctgcac gagcaatatt caagccttcc gggactttcc     89520
     ccgccaagtg tccctcacct gcggcggtta gggtcggcac cctgcaccct tgacaaccag     89580
     gaacgagcgc ctagcaggac taaaatcacc gcattggagt taattcgaag ggaagggaaa     89640
     aagctggcac gaatagaagg atcccggtag gtaggattgc ctattgtaaa tctttagtat     89700
     aaagaaatgt ttaatataat ttgataatac tgataataat atataacaca gtaacaacaa     89760
     cacccacaac aacatatcaa tggaccgata tcggttgaga gagaagcaat ggtaggtcta     89820
     tcaataccac tctagacgtc taaagtcaac tgctccagtc ttgtgacttc acctgcactt     89880
     tctggccctg ccgagagcta tattatatcc gcggctgctt tcaaccctgg gcgaagctca     89940
     gctattttcc ggttggacct gctcgtcgtg ccagagaaca gcccggatgt caacgggaaa     90000
     attttgtgtc gcgaagtctc caggggttca tggtaattca agtcagtctc caaccacgcg     90060
     ggccgttgat ggtttagcgt atcggggata tcggaatttg ctccggctat gtactagcga     90120
     ccaggtatct ttctcagtat acaaccaaac gatggaacaa aacccaaagg ttcgctttta     90180
     cttcctgccg gtatggcgta ttgagtagtg cggatagtag aagcttctca atgcctttgg     90240
     ttagtttccg caaattctga aacagttgta ccgaatacgg ccgtgctgcg gcagatcccg     90300
     accattttga ccaccgtcag cacctaaaaa ttaccaggcc tttctaacct ctgccaacca     90360
     cgctggagcc atggatcgtc gatcatcgta ctatggagat cggaaagtaa agagctccct     90420
     gcccattccc tcaaccagcg tgctcatgga acccctcttc aaaatgagcc acgttcttgc     90480
     tttgctacct aaaacttttg gttaggcaat ctactcggcc atggtcatga catgcttcca     90540
     ccagtgccgt gttgcctgta ccagatcccc agtccgtgaa ggtgacggtg gccgaaaata     90600
     gagcaagcac tgaatctcag gggtaacatg aaggggtcgg tcgaccgtac gaccaggccc     90660
     agcctggcca atccagatcg gcctcaatat gcctctgccc tatcgtaatt tcgcatttct     90720
     atttgtctta aatccttcta gagccttgca ctcgtagaga cctcttggtt taggattagt     90780
     agggtattga aaccccaggt aggtgttagg ttttactcgt gtaagatgct taaaaagggc     90840
     agaagggggt actttttccg tccacggatt gacctaaccc tattattacc ccctccggag     90900
     tgttggtggt aattaattat ctgggtcgtg tcgtcgggta tcggaatgtg ccccggcaat     90960
     gagctagccg accaagtatc cctactcaag atgcatccaa tcggaaagac aaccataacg     91020
     aatcagcttt tgctgtctat catgtaacta tatcctctac gccaggtacc aggtctcgcc     91080
     gtattgtagg agattctcaa tcctgctagg cttttctgaa tcctccgaat tttgatatcg     91140
     agaccaaaaa tggccatgct gcgacagatc ctgaccattt tgttcaccaa caactcctaa     91200
     aactggcaag gatagctgaa ccacatcttt taccccgtga ccttggtgat ccgtgatccc     91260
     taactttcaa agtctcttcc aaatccctca acatcggtct gacgcggaac tcgttatttg     91320
     gatatccaga ttcctcaatc acaataactg gaatttgtgc agcactatct atattgtata     91380
     gcttagcgtt gtgatagtgg gactacatta cgtgcttgct gccaaccgat ctgacgtaca     91440
     atctgtacaa tatcttccat tctgttcgat tgcctaaggt gctatcacgc aagagagaaa     91500
     gaatcacact tgaccctcag ggcctgcaat tgcataatga gggacactga ttccacactc     91560
     agaggtcagt ggggtggtcc gccagttgaa tatcgttgag acgataaagc actttttggc     91620
     gactcaaata aaagtgctga tttctgaggt tccggccgtt gaagtgggtg gccattacag     91680
     tcatgatggt tcctcacttc accgtcatgg cagtcctccg gcggatcggc actccgtacc     91740
     gaccgctgct gcaatgccgc agcgcccagc gtgcatgtcg gtaagcggca tcagaagagg     91800
     aactcccgtg caagacgacc acgtctgcat tcaacgagaa tatacgaaat gcttcattcg     91860
     gacatcatgg agatgccgat cgccaaagat ggctccaggt acgtgatcac cttgactggc     91920
     gattattctc ttggctcgtg ggcatatgcc atcagatgga agaatgaagc gctccagaag     91980
     tttcgacaat tcgaggcctg ggtgcactga cagttcggcg cccagatcaa acggttcctc     92040
     atcgacaatg ggagagaata cctaccggta tttacgagct tcacgacacg tattctcatt     92100
     tggtttactg gacccagccg ataattgaga atattaggcg gtacgagtct tttgctgcat     92160
     ataaggcgct gtacttgatt taatagaggg tcaagggcct gccatcaata aagtaaacgc     92220
     agcgcgaaga ctttgcctct aaatatcttc cattgctgcg aaaaatatgg ctaacgccac     92280
     acatggtcga tgtcacccag caacgcttaa gcttcgcccc tccccatctc aacagatctc     92340
     gtggaatttg gcggcactga cctttggttg cctactcgcg tttacatgca gtgagcgaaa     92400
     gacgactatg gaaagtgact tcgtggtaac atatgtaaac agggaaatag cccaagggag     92460
     gtttcttcgc tgattggatc gtgatattga acctggcgag tttaaatgga tcttccccgt     92520
     ggcttcaatg ttctttcttg ctacagtgct attaattcac gctatccgcc aagagtcctc     92580
     tgagataacg acaccgcttc gtgtctaggc tctacactct gtgatacgcg acggattctt     92640
     ttgaatgaac tattagcata caagttagga gactcaggcg aatgcttttt ccactccagt     92700
     aatgacaatc tgtcggcctt caagtggaca agcctagacc ctctgtccat gtctactcaa     92760
     gctagcgata ttttcctctg caagccaggg gactattttc tgaataattg cactagatag     92820
     tatttcgaca gcatggtttg gtgctacatc tgcgaaacta gaatgagcat ctgcgctcga     92880
     catagttgta gagagactaa cgagtacgtc actgtcctcc aagcggtgtt ccctggcgac     92940
     attaaagctc aacaaaaaga tgtgaactgc ctacatgcag gtggcaagag agctgcgctg     93000
     aagccggacg agccgacttc cgcaccgtgg ctatttcgag aacatgcacc agtcacgacg     93060
     gggaccattg aaaaggctac gacatcccac tggaaacaat ttctagatga aacaagtgaa     93120
     gggaaactgt gggaaggcag caacgtacaa gaaaccacca gtctcctgag gctgcatccc     93180
     cgcccttaag gtgggcgacg aggagctagt tgacaacagg gagaaagctc aggcgttcag     93240
     ggctcattct acccgccgac agcgactgcg caagtgggag cacccgctca cgccctaacc     93300
     gagattcgaa gccattcaat cccgaaactg aaatttatcg ataatttcaa ggctgcaaaa     93360
     ggcgcagcaa cgccaggcga ggacggtctc cgtacgttga tctgggaacg tctctggaaa     93420
     tatctcggaa acatcactac tcggattttc ccgtctcgat tgaactagga taccacgcac     93480
     agcgacgaag aagcgcgcga ctcgtagtcc tgcggaagcc tctggaacca actaggcact     93540
     acctaaagcg taccgcccga tctcgccact taacgcgctc tggaaattat tgcaaatggt     93600
     gatggcccgg cggctgccct tctttgcgga gcattacggt cttctaccgg atactctgct     93660
     cggaggacgt ccgggacgaa caacccgagc aagctctccc gatgcttgtt aatgcaatcg     93720
     accgggcgcg gtaaggcaga aggccgtcac actggtggtc ttcgacctga ggggggcttt     93780
     tcatggggta aataaggcaa gcctggatat tcgcctcagt ccaagggtat cgcactcgga     93840
     agcgggaacg tgaattgcga gcttcatgag gggatgccag gctagcatta gattcaacga     93900
     ttaccgagcc gaggtggtgc cgctagacaa cgccgggctc gtgcaagact ctccgctgtc     93960
     accaatcctc cttgcattat tcgactgcga tttggtcgac caaacggtcc attttcacgg     94020
     cggggcatat gccttcgtcg acgactactt ctgctggagc gccgcggaaa acttggtcaa     94080
     aaccgagtcc gaagacgcag ctcgtgccgc agcctgagtc cgaagaactg ggtcctgctt     94140
     cgctgcagaa aagaccgaac ttattcacat tacccggaag aggaaagaac agagccagga     94200
     ccagctggtt atcaatggta attccatcca gctatttacg actgccgtgt tcctgggagt     94260
     agtcttcaac catgagctac ggtagaagga ggacataacc caagccgtca agcgacccac     94320
     caaagccaac atcgcggttg ggggattgcg atagcttcgc ccagagcaaa tgcccagagc     94380
     aaatgcgacc gctccacgga gcgcgtctca tagcggttgt tgactacacc tcgaccatct     94440
     gatgcatgat ccacttcgag acgagaccta tctaagacac ctccgttccg tgaaatgagc     94500
     ggctttcatc cgcgtcctaa ctacctttcg aacggtggca acaaccacaa ttgacgtgga     94560
     cgcacatgta ctgccaattc gccttcgtct gtgcgaccgt tgcacaaaat atcatcacta     94620
     gactgcatac cccgcccgaa aaagcacttt ataggagatg ccctactccg agccccgaga     94680
     agacgtaaca atagtggatc gtttgcctgg ttcccgccat gggaacactt ggaaacaatg     94740
     aacctggaga gaccccgcta tcaccataac gaaagagccc tttccggaaa tcgagattaa     94800
     accagacatg agctcgcgat aggaagggcc gagactacgc gggcaaccgc ggacatcgtg     94860
     gtattttcgg acgcctcggg acgacgcggt aatttatgcg ccgcagcggc agtgctgaat     94920
     tactcactgg aaaaatcgac agcaagtaca ggtcggaacc atggatccca tacgcgggta     94980
     ggatctgcca tgctcgcgac agcaagtcgg ccctgcaggc ccagaattct gaaaaaatgc     95040
     cgggacaacg gatcacctat gccgttctac aggctaccag gaacaacaag accccatgac     95100
     aaatcgatac gactgcagtg aatggccgga cattaccgaa tgtccggcaa tggcaccgcc     95160
     gacttactgg ccagggagcc agccatacct ggaacgagac acacgttgtg cttttttccg     95220
     tctcgcgaga gaacacacat caggcaagga atccgcgccc aatggaagga aagatggaac     95280
     cacggcaccc atctgcgtca gaccgaccac acactgccgg ctgagtacac tagacggctc     95340
     tacggatctc tgcctagaaa tcgagagtac ctgacggcta tgtgtctgtg gcgaacggga     95400
     aagtgttcac cacgtggtct tagattgccc acatatttac aatttcttta actattattt     95460
     ctgttttatt ttctgaattc ttgccttaaa ccggggaatt ataaagagag agctccgaag     95520
     aaaggttggc gacgctttca actgcatgtc aacgctgtga gttatacgcg aaacggcggc     95580
     gcggccgact atgcgcttgt gacgacggat gaggtcgcgt tgaaaccaat gaatatcagt     95640
     gccgtggagg cagcttcggt ggttacgcca gctctggtag cttgccagac gcttctccgg     95700
     tattgtggga ttggggttgc tgcgacaagc agtgagaatt cgatcaattc gcagccaaca     95760
     cgtgcgtttg tcgtagacgg ggacgacagt aaaatcggac gaattgctat ccagcttttg     95820
     cgggcgaaaa atgcgacact tcctttcgct agaccatgga tcggcgctgt ttgtgaacgg     95880
     caggaatcag aggcgtttag ggatgaatcg ggtgtggacg aggtatttat tatcccgcga     95940
     tcttcaggtc aaaccgttga tctcactgca acgctccgtg gttgcaattg gggttcgatg     96000
     gacattgtac tggattgttc cgttggtgct accttccaac tgcccaggca tcctccgtgg     96060
     tgaagaataa gggcctgtta atatctcttg gagtacggtg gcctgaactg gagagcacag     96120
     taagccgggg gcaggatatc ctgtctccga acaatagcgc ggtgcgattg gaaaatgctg     96180
     ctgcatcggc agacgtggct gcattggcgc aaaattgtag agcttgtttc aggaaatatg     96240
     atcacagttg gcgacaggac tgtcatagat ctggtggatc cgactgaatt tgtaagactt     96300
     ttccttcgct gcttttccaa actctgcgcc gttactctat gttatttaca gaaggaattt     96360
     gcgacttcgg gaagttaacg caacccgaaa gtcgttgaaa agcttagtcg atgatgctgt     96420
     tttcacccgg aggtcataat ggggcttttg ctggttcgag ttttcgtggt cttgcgcaat     96480
     cccaaatcgt gatttatgtt gtctgtctgt gttgtcagtc tgtggatcgt gacaatggta     96540
     gatgaacgta atgtgggtac tttgctgctt gatgacgctc ttcgtctgaa gggcaattat     96600
     tcatctttga gggcttgaga agtaaactcc ggttcattta caggggtcag tatggcaaac     96660
     gagccgttaa gccgagctta gaatatacta gatgaagtct ccgtcccaca ggggatacat     96720
     cagattgatt gtgggataaa agcgccattg gccaattatc gcgtgaaacg atatgatggc     96780
     gcctgtgtag actccataaa ggcagtgggc ccgccacctg atagcgttga catggttgag     96840
     ggttttggag ttatatataa ggcgcacgat gcttcattcg ttcgcagatc ggtttaatgt     96900
     gcttgttggg aatgttaggc gagccatgtt tgttccttaa gacacgcttc tggatataat     96960
     taacggatgg attatgtgag tatgtgagtg ttgaggaagg aggcttggtc caagcatgta     97020
     attcgggtga tgtcatgtcg atcctctaga ctgccgcctc ttgcgtggcc caatgtacaa     97080
     cttctgtaaa acggatgcga aaatatataa ccaagtaacc aacagattta ttgtgtgtcc     97140
     tgcctatctt gaacattaaa agccatgcga ccaggtccaa aatatcatcg cacaatatcc     97200
     tgataagtta ctgtagactt gccagggttt cacttgctgt cattatgaac ccacttgagc     97260
     acttagatta ctaattggcc ggctgtttgt tccgagaaaa cctagaatgc gcgcgaaggt     97320
     gagaaaaatt acttccatcc atattctgac tgtagtagtg agtaaagacc agtgaataaa     97380
     ttaagaaggc gaatttgctt tatgacataa tctcttctgc atgtaaatgt ttgccgtaaa     97440
     gattgatcat tgccgcatct tgtttgcgca gtgatgtaag agttgcatga cacaaacggc     97500
     cctttactat ttattctaag agggccttcc atatcttgta actctgaagc tcctcaccac     97560
     cggataaata agcgaagact gcgtcaccct ctttttattt cttatccttc tacaattatc     97620
     ctatctcatc atcgtaatgg agactgtcaa ggttcgcaac gccctattgt gtcgctccat     97680
     caaatactaa cagatgtcta cttcagaacg ccgcaaacta cgtccaggag tctgttcagg     97740
     gcactggagc cgaggcttcc aaggagacca acaagaatgt cgctaaggac tctgatgcta     97800
     gcttgaccag tcgagcaacc gccgccaagg atgccgtcgt cgacaagaaa gacgagaaat     97860
     ctcatgacgc caaggctgac gttcacaaag gtaatattag ccacagtgtc ccttcgttag     97920
     atagcatgga aatattaaca atgattaaga agccgcgaag aactagatgg acggttatgg     97980
     aactgggaat tgcgatatgc atgaatgcta tatccttgct agaaagtaat ggaaactact     98040
     tacagctcaa tcctgtgttc ttctaagaac atttgtgttc ttctaagaac atttgcttga     98100
     cagtaagcat gaccagtgta ctatcccact tcaagtatcg ccaggacatg gtatgcacgc     98160
     ctctcaagtc atatacagcg ctaggcggac atttgaaggg ctacaatggt acgaaaaaat     98220
     ggcagtagag atttcgttgc actgtaatca tggtaccttg ctcctaggat tcactcgaat     98280
     agaatctcac tacatgtcat atcctctact gtgaaactgt agcgcggatg gatcacccag     98340
     gtacgtcgtt aggtttggag ttaatgtagg tgacggtgat ggctcgagca cttaagaatt     98400
     attaattggc cgtctgtttc ttccggcaaa acttagaata tgcgggatgg tggggcaaat     98460
     tacatccgtc attgttgtga ctataagtaa taagtgttgt gatatgaggc tggtgcagat     98520
     caggaaccaa gccgcatcgt cggaattaag tccgaatgcc tatacggacg accaacttga     98580
     ttggaaatca actttgccta ttgttgtata tatagcctca tgttttccct ctgaaatata     98640
     accaattcaa ggatatacct ctgaactaca acagtaagca tcagtgaaag gcttgtagtg     98700
     ggcgaatttg cttgtgacgt aatttccgca catgtaaaag tttgccgtaa atttccaata     98760
     tcgtgtgctt cgttgtacaa gccgtttagt catttgccgc atactgctgc gtggtgatgt     98820
     aagagttgcc tatcacaaac ggcccttttc cattgaagaa ggccttccgt ctcgtgtaaa     98880
     ccggtcttct agttcctccc tcacagataa atattcgaag actacgtcac ttattcatcc     98940
     ttctacaatt atcccacctc atcctaatgg agactgtcaa ggttcgcaat gtcgtcatcc     99000
     attgtgtcgc tcaatcaaat aataacaggt ttttacttca gaacgccgca aactacggcc     99060
     aggaatgttt agggcactgg agccgaggct tccaaggagg ccaacaagaa tgtggccaag     99120
     gaccctgatg ctagcttgac cagtcgggca accgccgcaa aggatgccgc cattgacaag     99180
     aaagatgaga agttgacaga aatccggtgt atggcgaacg tactggtaaa attcacgatg     99240
     gtacaattct ctaactaact aaatacaaca atggtctgaa tataacaatc tggtcagaca     99300
     caattagtaa gcagaatgca tagtgaaaaa gtcacatgtt gacagggtaa aaagacagta     99360
     tcatcctgta tcttgacaga agtcccatca tgtcaaggcg gacgtccaca aaggtaattt     99420
     aagctacagt gtctctttgt tacgtggcat ggacatgcta acaatgtatt agaagccgcg     99480
     aagaactaga tgggcggata tggacgtgaa atagcgatat gaatgaatga tgcattactt     99540
     gctagaaata atgacggcgc caatcaggcg gaagaagcgg ggtttgaaag cgagaagatt     99600
     tacctaaggt atcggctttt gccaaattaa aaccccacag catgttctgc ggagcggaaa     99660
     aatctgttcg ccgtttacaa ctgggttgaa tcgaattacc ggtgcaagaa gatacttttg     99720
     gttgatgaaa aagaaatgtg ttcagtctgt gtttggctgt cttaagaaca aacagcgcaa     99780
     ttgacaattg ataatgattt acagctttgt ttcataactg aatggtagac tgaggactta     99840
     agccgcttac cgcaatggtt tcaaggcacg gcatgatcta tcaaaggtgt caagaaacgg     99900
     gatgatactg tctttttacg gtgtaaacat gtgacttttt tattacgcat ttgcttacta     99960
     attgtgtctg accagtttgt caaaaccaag ccgtcgttgt tttataaata tgggcctgtc    100020
     attgcggatt gaatatctcc cacaaagcct caatttaaga gggccgtgaa ggattcaaca    100080
     gtcagacaac gttgcttgac cgactcagca tccctttctc tcagcaccac tcttactcgc    100140
     ctctctcgct gggcatctag aggcatcaaa aatgttgctg caaatagttg cggtaaaaag    100200
     aagacatggg tctcaacagc cctcaataaa aataggtatc cttcaacgct ttctctcaag    100260
     cttgtgagtg tcagaagccg agaagcctat aaatacgtcc cctacaccca gcaattgctc    100320
     tgcgatttat tcacttgact ctgcaaattc aagcagggtt gtgtctgggg cacttgataa    100380
     gttctcccct ttgatcgagt actggaattt ctaatttact gacatttata gggtacatcg    100440
     tggaccagca agtcagacag tgtctgtggg agatgtggtt ccgcagcaga tccactgtgc    100500
     cattcaaacc aaccgatcaa agatacgaga tttgggttag ctaactagtt aaagtgtcta    100560
     tgcaaagatg tctccgctat agcagctgac tgagctaatc taatgtcccg cctctggatg    100620
     taccctcaaa gttgaagcgc gactgctcat gctgtagata tgtagaggtc tggaaatcct    100680
     gtttgaaact gcactgactt aaagacgcgg aacaactaga tccgtggacc atgcacccgt    100740
     gcaagggcca cagctccctg tcatccctcc acccctggtt tcgacgaccg gaacatgtga    100800
     gtcaagaaat gtctcgctga tctactgtcc tagctaacgt ctgatagtga accaatgata    100860
     gcgtacgtac ccgagtgtcc tcccccgaga tccagcgcta ccgtcagtgc tccccgcaaa    100920
     gccatggctt acgcactatt ccagaccccg ggcttcgaac aatgcagcat gccctaggtg    100980
     gaagattgta aatcaaggta gcgggtcaac aacagggtgc ggctatccac ttgagagctt    101040
     cgttgcatag aagcttgaga cgtccgtcct tcctggtagt gagtgagtta tcgcgctttc    101100
     tgctgcgtcg gatccgatta actataccaa gccttgtgcg ccaaaccacg aacaccactg    101160
     acaactttat gccactaggg actaactcat cgccacccat gaaaaatatt gtggccagtg    101220
     acctattccg ccggatcaga gataaggcca aggtggtggg catacgacgc gtgctccatc    101280
     gcgtcttccg ccctcgtccc caccgccttc acactattgt ggagtcctga acctctggca    101340
     tcgcgacaca ttcatccacc atggaagtgc aatgtttatc gcaattgggt tcgtaacgcg    101400
     catttactgt ctcaacaaat cgtcttgtgc accccagcgc ggctttttac gcgaccgccg    101460
     attgcgatga gcttgaatgc gacgtggcat gactgttcac tgcattgcag agagttgtaa    101520
     gtgatatagt tgggaaactg attgtccgtc tcaagcgcac attttggggt gcccatgaat    101580
     aggtaagcta cgacaactcg tccaactaga tcagtccttg ctgactcgga tcgtacaaca    101640
     ggagaacacc ctcatttctg tcactcgagt cgaatgccac gcgaacaaat gtcttgtctg    101700
     ctcgagctcc cctataccaa tacgatcgca tgctccctat cccttccaca tgactactat    101760
     cgactatgag tcaccagaag atccgtaccg cgtacatcgg cctcttcctc cctattgatt    101820
     ctgtgtatca ggtcattgtt tgatttgtct acatgataca acacctaaac tccgacatac    101880
     ctgtggctaa gcgttcaaac cttcaaatac cttcaagcgg cgtaggctgc tggtgtcgaa    101940
     tgtgtgatgt tgtcctcggc tggcatttgg tgtccatcca agcctgcaaa tctgaagaca    102000
     ccgaggaatg atgatgttct gtcttgcttc atggcagatg agctgtacct ccgcagacag    102060
     ccaggcggtt agcacaagtc cacctgcaag gagcaggaga cgcgaagtct ccacattctt    102120
     agcctactag ttgacattgg tctatctcag gtacaaaccg agaggttaga ccggggcaca    102180
     ggcaaaccaa ttacccaaga atcacctcgg gcatacacga agctgagtca tagggctgtc    102240
     gaaagtgttg tggtgtgctc cgttggacaa gtggtgcgta gattttattc ttatgcacgc    102300
     attttcctat ccaagctgaa gcactatgtg cagagaccat ttaccctggt tgtcactgca    102360
     gctgcaggtt agtcatgttg cccacgcgta tccttgtccg ttcatatcgt ctcctaacat    102420
     atcacgcact tgtcagctaa gctgccttct ctacatcccc tatctcgagt gttctttgag    102480
     aataaattat atattcgtcg agctcaccgc gctgcggagg acacgtgggc atgtcactgt    102540
     tcgaacaggc agccactgtg aagactttgg tgtccggaac aacatcgaat cagaatggtt    102600
     gtgggacctc ttgggctagc ccctagatcc tggagcaaaa tttctaccgt caatcaacgc    102660
     tcatgtgatg gctgcttttg gaaggatggc cggagtgtct actacgacta cgagcgaact    102720
     agcactcctg cgaggacacc accccacgaa aattcgtttc ggatggcact gctagacgcc    102780
     aatcgtattt caaccgtgtt ctcttagcag cagagcgtgg ttgatcgcat gaacttggga    102840
     catcacttcc caaaaggcaa tggccgtcac ttcgatccgg gagattggtt gataacccgt    102900
     cgttgttgag gcatagtaga aggagccgac cggttattct tgattgcttg cttgtccaaa    102960
     gctctcagca agatggttgt ctctggtaaa attactttga ttcttgcgct ttctgggata    103020
     taagagctga aatagagtaa ggttgagtga cttagaatcg ccgcctgaag cgatgacttt    103080
     gacttcgcaa ggcacaaagc ctaccgcatg gctaattcta ctcaagccaa tcgttcggca    103140
     cctcatcaca tggcttctac acgtgggtct tgggcttatt gcttggtcat aattgaacca    103200
     gtggatctac aacccctatc ggattgaggc tgtatgccaa cttcaccgag tgatcaggat    103260
     ggaactagaa atggcttgcg aaatagaatc gatagtgatt gatacatttt catgtgggtg    103320
     agatggcaag aaaacctccg tactacgtcc gtgagacatt gatagacctc gccacgggcc    103380
     atggggccca tggattcgga ctgagttact tcccggttga ccgtgcccag tggcatttaa    103440
     tgggcccatg ggtcgcttac taataagcac ttcagtcact tgaagtttta taatttataa    103500
     tgtttagcca cgcacgtata tgtcctatag tactacgtat tcaggttatt tgggcagaaa    103560
     gatatacaat ggatgtgttc agctataagc aagcctagta aaagcaatgg actatcgagt    103620
     ctaagtgaaa ttaaaagtgt gatcaaaata catagaaata gtgatgcgac tgtattacgt    103680
     gtaaagatat atatgactac aaaacatgct gaacctacaa atccactcat aatgtaatgt    103740
     ctaccagtcg catcaataaa cttattataa acacgacata ttcattatac tacataatag    103800
     gatgcacctt tattatgatc aattatctac tatgctagtg gacattgggg gtaggtgaca    103860
     gtgatagatt tcccaaagtt gaacccccta ttaaagaagc ttacataata caatagggga    103920
     tggacggtcc aatggcgagg tctagacatt gaccacctcc ttcaccgccc gatcattcac    103980
     cacaacactc accacaacac tcacatcaac actcacatca acactcacat caacactcac    104040
     atcaacactc acatcaacac tcacatcaac actcaccaca acactcacat caacactcac    104100
     atcaacactc acatcaacac tcacatcaac actcacatca acactcacat caacactcac    104160
     atcaacactc accacaacac tcaccacaac actcaccaca acactcacca caacactcac    104220
     cacaacactc accacaacac tcaccacaac actcacatca acactcacat caacactcac    104280
     atcaacactc acatcaacac tcacatcaac actcatgttg aatatcacgg cggccaaagc    104340
     ttatggcggg gattgggaat agatatataa agacgggcta cccctctcct gtaaataggt    104400
     caacgaacaa gcaatcaatc atatatctca acaggttatg agcccggggg cgcaaccctt    104460
     gggcacgcga ttaggcagca gaaattcaaa cagacaacct tttgactgcc atctacagct    104520
     aagcttcccc atgaagtgaa agacttcatc aactcaagga tctgaccaca ttgattcagt    104580
     aacttggtga aaaaccgtcg aagtcaagag ttcaaaacct ctgggggaaa tgaagagaat    104640
     cgacctcccc ccgatacgaa tcacagacat cacatcatca tcactatcac catcactatc    104700
     actatcacac tatcacgccg ccgtcccata tgatttgatg accgaaatcc agctgaaacc    104760
     aaatcacaac ggggacaggg ttggatcctg gctacatata tcatcctctt ttcaacacca    104820
     ttaaagcaag caggaaggat gacgaggcgc aaggctcaat ctactactat tccttctcag    104880
     tcccagaaat tagttccgcg acaaccttgg catcggtgga cggatgaaga gctcaattta    104940
     cttgcgtatt gccgtacccg tcactggtcc tacgatcgaa tcctaaggaa gcacttcccg    105000
     ttgttcacag agtcgtcact ttggggggct tatagccgta tccctcccaa ggagcgtgca    105060
     caccgtgcgt cgattttcgc tcgttcaatc accacatccc gcactgcccc tcgaaacaaa    105120
     gattctacac gtccccatcc tgtaccggaa acagaccatc gatctcatcc tgcccctcag    105180
     ccagaagcca acatcggagt tcataaatct tctgcctcaa ggggtgagga agacaaccaa    105240
     acgccaatac ctatcgatgg gacaaaccgg tacaattttc ggccaaacag atatagaagc    105300
     tttcaggaaa gccagacaca atatcctatc gatcgccttc gctttccccg cttcttcagg    105360
     tcatataaaa accacttgaa gttggacggc gtaccagacg gagactacgc tcctccacct    105420
     cattcgccca cgccagactt atctgaccgt agcccttccg tcatctcgag tctgcctagt    105480
     gccgcatcaa gtctagaact ctttggttta gaagcgcgtt cccttagctc atcagatcgc    105540
     gactccttgg ttaccccaag tctgcccaac gagggatcaa gcccagtcca acttacgggt    105600
     gcgtcggttt cctggtcttc taagagacag gggaggtggc cacttctacc actcacgccg    105660
     agtatgttcc aatattgaag ttatgctcaa cagataccag gcatgaatcc gagtagctcg    105720
     ctggaaaatc ttcgttacaa tttctattcg agaacactag ccaaggcaca tagcgcaaga    105780
     cccattgtta aaaaaaaaaa aagaaaatat atataggtaa tgggaattga aaggaaattg    105840
     agcttatggt cttcctcttt ctgccaccag accggagacg cccttgctga ggcgatttcg    105900
     agcgacgatg gaatggatct agataagctt tgctactaac gagcgtggtg tcaaatcgcc    105960
     atcggtggtg agctggggta acaacttatt tcgctatttt attctatagc cgaagttaaa    106020
     agtccggtta ccaatgtgtg atgtcgttat tgcctttctg gtgggccaag cttcgttcta    106080
     gaattgacaa ctacaagcca tttcgcctct atgagccagc ctttcacaat acctgccatt    106140
     ggttggatcg cgcggtgcga gccatatttg gtcagacatt aagaagtcat tgacattaca    106200
     aacaagtata tggccgtact tgggtggtca tctttccggg ccacggtggc aaaatagaca    106260
     gggtgcgcca gaatcactgg agctttttat gatgtccgcg tcagttttga atacaaatcg    106320
     aacttattcc acggtgtata tgaactaatt ggaaccctcc acgcttatct ttccatagcg    106380
     ttttacttct cgcaatgcat caacctttca agttctgtgt ggaacgttat taggcgctat    106440
     atcgtacaat atgctactgc tcgagcttcc gaataccgtg aacatattgg tccaggcaac    106500
     gtaacgtatc tgcactccga ctttgggggc ttttcatctc aacggattgt gtcctctcat    106560
     aagttcagcc cgtgtagtgc gatatgtggt ccgcattatt ggcggatggt gtggttgtcc    106620
     atgggatcat gactatatca taacagccaa gcatctccgc cggatgtagt aacgttaaaa    106680
     tgatgcgcgg agagccgctc ttttttatac gagggcaaga actacccgtc ggaggaaaaa    106740
     ttgcctctta ttatcactta tttgaaacgg ctcatttacc taaccaacat gtctacagaa    106800
     gacaggctga acaaaatgcg tgatttaaag cgtaagtgtc gccttcgtaa gaagcatata    106860
     taatgctcaa ggtaaatcct tcatagcacg ctgagcgacc caaatgtctc ggaagaagca    106920
     aagcggaatg cacaagctat gcttatggag ttcggcggtg accacccact ccaggtgtta    106980
     tatcaagcaa ggggcgatca aacgagggat ccaatgaggg tctcagctgg gcttaaggca    107040
     tgagtatgac ctttggggaa aatatgattt acggagtctg atggcctaaa tttagcgcac    107100
     agcgtaatcc tggcgtgacg gagggcgaaa agcagaaagc tgcttggatg taggaaggaa    107160
     atgttgcgga tgagtaggta aataaatgtt ccatcgatca taaatattga aacgctcgtg    107220
     agaagtaaat gtcgggagga tacaatgtga catacaatgt gggtagaagt ttctgaattt    107280
     caagcggact tcgcctagtt ataaccagat tctagtctca gtcaatatct acctgagaat    107340
     ctgcatatta tgccattctc tcaacttccc atcttgtatt cggggttggc ccgtttcgat    107400
     ccaataagca gctacatgta actgcctacc gcgcctgggg aggttctcgc ctcgtccgac    107460
     ttgcgggtgc atttccaatg accatgctgg aaattttgtt accgactgct ggtgtgcaaa    107520
     gagcgatttt tcctagaacg atattcctgg caactcatcg attccggtat gtagacaatc    107580
     agaggtttct ggggactgtt tcctcgctgg cgaggaaggc gtacattcgc ccttgtcaag    107640
     ttagtctgta ccttagcaca tcgtgaagtg gcagtgacgc gaaaaattga gtgagttaag    107700
     ctgttgtcgt aatgttgtac gaagctcgtc ggatcccacg acataccatg ttactttgga    107760
     cggggcgaat gctgtaaatg agaaattatt cgctatagcc aagactcatc caattgcgct    107820
     acactgtcgc cggcgtccaa aaattttatg aattcaattt tagccactgg atgacaaaga    107880
     agggcgctag agagctttca tatggtttta aagctatctt tttggcttgt ggtggcattt    107940
     acttgctgtt tttccctctc tatataggct ctcattatta tttgtttcgc cgagccaaat    108000
     atgcatcagc atctcaatcg cgatcgtgtg caatttgtag acctggccct cctggatgga    108060
     ctaaggaatg aggaacttat agccaccaat gacatgaaca gggaagctcg agccgatcgc    108120
     tgggtttttg gttttacaga acctttcaaa atttattgag acggccacag tgtgctatgc    108180
     aggtggagac aacagtagtc ccgtgttcaa ataccccact cagttaacct gttgttcatc    108240
     acagcggtca agcatctgcc gcgatgtcta cacaccaacg actcaaattt ctttaagtgg    108300
     cagcttaccg cgagaaatag gaggagattt cttcctgctt cttcttcctg catgatgtat    108360
     cgtattatgt atgcagtttt ggttccttta gagtgataaa aaaataccaa agcacgaagc    108420
     ctgagatccg ccattatggt gcttctgctt gtgacatcat tctagataga aggcttaaat    108480
     ggtccgctcc ggtaagtggt gctgtgaatt gcgaaaattc aagatacttt tcaatgcagt    108540
     tgacaacata gtcatgagtg tactacgtca agactttaag agcctaataa cgcatcttga    108600
     agcaactctg acgtagtatc agtacccgct gttctagaac aatacatata tagaggattc    108660
     tctcctaatg atacggatta atatgatcaa ctcttctgca actaactgca agctcagcgc    108720
     tttgctcata taacgatcat agtttggagg aaactcatcc aagaacattg aaaatctatc    108780
     attatgccat taacagcaat ttcaatgccc attacgatcc tgacccgctt tatgcaatgg    108840
     tcaagtgctg tcattgtgat gggcatcacg tcgtacttta tgcataactg gccgaaagga    108900
     cagcacacca tctatcaaga agtcattgta tgtatagctc gcattgaacg aggctttctg    108960
     catgatcctg gtctctaaca tggctgcagt cgacgatatc ggttgctcta tttctgcccg    109020
     ccttcgtgtc cccctttatg ccaaatctgc tcagcaaatt cgttaccccg attgacatca    109080
     ttttctcata cttgtgagcc atgttcccca tgcgttcgag cagaaattga tttgaagttt    109140
     cttaggtggt tgacggcctt catctttgcc gctcaagact acaactggaa agattgttca    109200
     caaaatgctc cgcctggagc cagctgcgcc ctcaagaaag ctaacgagtc atttatgttc    109260
     cttgccttgt gagcccttcc atcttttgcg ccttgcttag aaatataccg aggctaacac    109320
     aaaatagttt ctttacaatc cttgcaattt tcctggagct attcaatctt tggtctcatc    109380
     gcaaagagag tgaaatttcc gaggacagaa aacatgacgc tcattctcca cacaatgggc    109440
     ctagcgatac ggctgcctaa aactgggtcc catggattgt ggccaatagg aataggacct    109500
     tgattgatga tccttactat tgatcctacg accccatgag cggggcaatg ggaaggccct    109560
     ataagcgtgg ttttcaacac tagccaagtg gcgaacagtg aaagtgagga aagcttgcca    109620
     tgagctggcg gctggcttat gtcactgtgt gcgtgtgtgt cttgacgata ttagtggggc    109680
     aacgcgggag tgtaggatag cgtcgcaatc ttgcgagggg tggcgatcac gagaacctag    109740
     ctcgtgagcc ttggttgcat cagttcacat ggttgtcctg gagactagac ccagtttctt    109800
     gtctgagctt ttcaaaaggt ctggaccttt tttggctacc atgccctccc aaggaaagac    109860
     aatcttcatc ctgagtttga aagtatgcca gtgcctgtgc gcccagggag tagagatttt    109920
     agtaaaggca acataagttg gctgcgagta gaaaggaaag aaataacatt cagcggcgcg    109980
     gggctaggga tgaacaggat tgattctagt gagaccaaac ggtcctccgg ccaaccgcag    110040
     gtacagctca gcgtttccgt cggccacaaa gtctccaacc cattatttcg gcatcagtcg    110100
     aagcacttca accctcatga aagagacggt gaccgtggct agtgagcatg gtcaaaacgg    110160
     gcagagtagt ctgccaccgc gttgatgaac aatcaaccat tctcgatacc agacagctca    110220
     tgattcaata acgcatgtgc aaggattggc aaaatatgaa ctcatggtga gaagtggatc    110280
     cggaatgagg ttacaagacc agcaacgaga aataatgccg tgttgggaaa gacatgaaag    110340
     ctacatcatg gatatctgct gagctcgatg tcgccgagtt cggccagtgg ggatatactt    110400
     ttctggaacc atgcggggtc tctgagctcc aaagtaacat gtatgtgttg tgatatgagg    110460
     ctggtgcaga tcaggaagca agccgcacca tcggaattag ttccgaaatg tctatacaga    110520
     caaccaagtt gattgtaaat caacttggct ccgtgttgta tatataacct catctttccc    110580
     tctagaataa gagacaattt atacctctga actacaacag gttatgagcc cgggagcaaa    110640
     ctctcgggtg ccgtttctac tcatctgaga atcatcttga ccatcttgat tatatatcta    110700
     ccccgctttc attatcctca ctatgtctgc tctggtccat gactcgcccg accgagcggt    110760
     cacggccatc gagcctctga caggtagcga caatttcgca acctgaaacg tctcatgacc    110820
     tcctatctca aagcaaggca ggtctgggat gtagtggcgg gcgaccttca gcgtcccgat    110880
     tgtctattca agtacgccaa acccattacg gcggatatcc accccttggt ggagccccac    110940
     ctcaacgggg cgtgaggcag cgagccattg aagcgcgcct cgaagtggag gtccaggcgt    111000
     tcgagcgcca ccgtgaacgg tcgcgtcgcg aagccgaggc ctaccatact attttccggt    111060
     acctgtcccc ccacattagc attcatgtcg cgggactcga gacgtcccgt gacctctgga    111120
     atgaacttga agaacgatac cggcggatgg aactcgccac gttctgcgag ctgttcgccc    111180
     agcttcggga aaccactggc gagcgctgcg gcagcgcgcg cgaattcgtt gatcgtgtac    111240
     ggttgctcgt acatcgattg aatgctatcg tgcccggatc gattggcgat cgagcacaca    111300
     tcgcgatctt gctgacgcag attggaccgg aatatgtcct gattgtggat gccattcaga    111360
     atgacaagga tccggtgaat ccgaccacga tcggaaaccg tctgtctaat gccgaacaga    111420
     cggttcggag gaaagagtca ccaacacccg tgcaggcagc gtctggcccg tccgtcaata    111480
     cggtgcagca gactgccaag aaatacaact attgcaagaa gcgcggccat gtggtcgcgc    111540
     agtgctggaa gaaacagcga gaagcacagc cgtccaggga ccatgccctg aaggctgaac    111600
     ggagtgtttc cggctcacca agaaacagtt tgcaaaatat accatcaagc caggtggaag    111660
     atcggcaggg cccgccgact tccaagagac cgaggatcaa tatcgtgagg gcgngggtga    111720
     cgacccttta tacccacgca ccgcaacccc ggtggattct ggactcggcc gccaccagcc    111780
     acatctgctg ggaccggagc tgcttcagca gtctgcggcc ccaccgcgag atgctggaca    111840
     cggcgggcga tccagtggaa gccgaaggga tnggtacggt gaagctcacg ctccggggga    111900
     agttcaacca acccctggtg ttaaagaatg tgtacttcgc gccacgcgtc gggatgaacc    111960
     tgatcagtgt accgaagtta ttgcgagacc gctactcggt ggtggcgcac ccgcagaacg    112020
     tctttgtgca acgccgagga cggacggtgg ggaccgccta ccatgcagag gaggatctgt    112080
     tgatcctgcg gtgctatgtg agcaagagat ctcgagagcg agtccaactg gcgagggcgc    112140
     cggcggccca tggccatgca gattccctgg aactgcaggc ggtggctatg gacgtcgacg    112200
     accctcggga gtcaagtgac gcagaatgcg cagcgtcaac ctctgaactc ggtggtgaag    112260
     ctgtgatact cgaagaagat gcgtgcaaag gagtggatca ggcctccgaa gcgttgtggc    112320
     acgctcggat gggacatctg aaccggggag acttgagggt ggtcctccgg cagaccggca    112380
     ctccgtaccg accgctgacg caggcgcagc tgctggcaac gccgcagtgc ccggcgtgca    112440
     tgtcgggtaa gcagcatcag aagaggaact cccgtgcaag acggccacgt ctgcattcaa    112500
     cgaggatttt cgaaatgatc cattcggaca tcatggagat gccaattgcc aaagatggct    112560
     ccaggtacgt catcactttt actgacgatt attctcgtgg ctcgtgggca tatgccatga    112620
     gacggaagca tgaagcgctg cagaagttcc gacaatttga ggcgtgggtg taccgacagt    112680
     tcggcgctca gatcaaaagg tttctcaccg ataacgggag ggaatacttg cccgtcggaa    112740
     cacacctcga gtcccaggga gtcgagtttg acacttcgcc accatactgc aaagggcaga    112800
     atggactggc cgaacgcacg aatcgcacta tccgggagcg gatcaacacg ctcctgtccg    112860
     atgcgagact tcctccttcc tggtggaccg agcttttaga aacggtagtc tatctgaagc    112920
     tgcgcgctcc agcatcgatt ttacagaaga agacaccgtt cgaaatatta tacgggaagc    112980
     cgccctcgct gctgcatctg cgacggattg gctcccgcgc atgggtgttg atcccgaaag    113040
     agcaccgagc aaaactcgga cccagatcat ccgagtgccg attgctaggt tattgtggac    113100
     cgaaccagta caagctgtat gaagtccatt ccggaaagac cgtcttttcc cgtgatgtcg    113160
     agttcgatga gaggactcca gtggcgccac ccatcgaggg ggaaacaggc aacgacctcc    113220
     cggacaacgc tcctccatca cgtgtttttc caccagcggt gccatctcca tctagcgcat    113280
     cacctgggcc gcctgcatcg cctccagact cggctgaacg accgaagacg ccatctcagc    113340
     gtgtggaaga agcacttcca ccggtcaatc caatcgaaca ggaagcagag cccacacagg    113400
     atctcggcta ttccatctat ggccgcagaa gaagaccctc acggcgcctg ctggaatcac    113460
     ttgggaaggt atacaccgca ggcacactaa gagctgcatc tgccagcaca gtcgatccgt    113520
     cgacttttca cgaggccgtt tcgggcccga accaattgga atggtgggcg gctatccaga    113580
     aagaatatgc gtcccttctc gaacacggaa catgggaaag ggttcggcgg gaggacgtcc    113640
     cagccggaga tcatgtgatt ggctgcaaat gggtcttcaa gaccaaagcc aacggaacgc    113700
     gcaaagcgcg actggttatc aaaggctacc ggcaaaaaca tgggattgac tatcacgaaa    113760
     cgtttgctgc tgtgtccaga atggactccg tccgctgcat tgtcgccagt accgtgttgc    113820
     gcggatggaa actccaacaa ttcgatgctg tcacggcatt tcttcatgga gacgtcgatt    113880
     cctctatcta tatggagttg cccgaaggct tcgaagagcc agggtacgta tgccggctgc    113940
     gccgctcact gtacggactg aagcaggctc cgcggatttg gtaccaatgc gtccaccgcg    114000
     tcctggcttc tcatggcttc accatggccc aatcggacaa ctgtgtgttc tacaaaccgg    114060
     attgcgtcgt ttgtgtttat gtcgatgact ttcttgttgc cgcggcaaac acgcacgaaa    114120
     tcgaacaagt gcaacgagcc ttgcaaacag agttccgact gaacgatctg gggatccctc    114180
     gttcgtttct cgggatccag ttcgattatc acgtcgatgg gtccgtgtcc attcaccaac    114240
     accagtacat ccagaaggtg ctctccgact ttggcatgga gagttgtcaa ccgaagtcta    114300
     cgccgatgaa tcccaagcaa atcctgaatc atcgtccaga cgaggaatct ccggacgagg    114360
     aagcaaaagc tcgttatgca actgccattg gttcgttgat gtatctgatg gttagcacgc    114420
     ggccggatat tgcgtttgcg ctgggcatgt tgagtcgctt cacgtctcag ccgcaatcgc    114480
     accaccaagt cgctttgcag cgattgcttc gatacattaa agccacgcaa tcccgtcgta    114540
     ttacctaccg cagtgggcag ctgatcgggt atacggacgc cgactttggt ggctctgtcg    114600
     tcactgacgg tgcatactcg acgtctggat atgtattcca gcttgcaggt gcgccagttt    114660
     cctggtcgtc caagagacag ggggaagtag ccacgtttac cacacatgcc gaatacatcg    114720
     ggcagtacaa tgccattctg catctgcagt ggctccgcac ctttctagct gaaacgcaac    114780
     tgtatcggtc tccggtcacc aacatcatgg ctgacaacca gtccgccatt gctctttctc    114840
     gcaaccctga attccacaaa cggacaaagc atttcaatgt gaaatttcac tatcagcgag    114900
     ccgtgctgaa tgcaggcgag attgggtttc aatatattcc aactgagaaa caggccgcag    114960
     atggtctcac caagccattg gggcctacgg cctttgccaa attctgtagt ctcttaggag    115020
     tcgacgcctc agagactcca aggcaacatg catgacagcg cgggcgctct ttccacttta    115080
     ttttcccacg aaggtttttt ttgagtggtt ttactgaggc ctgactgctc tgcgcaattc    115140
     cagtatcgcc ctgccagcaa agcgatcctg agggggaatg ttgtaatatg aggctggtgc    115200
     agatcaggac gcaagccgca ccatcggaat tagctccgaa atgtctatac agacaactaa    115260
     gttgatttac aatcaacttg gttccgtatt gtatatataa cctcatcttg ccctctagaa    115320
     taaaacacaa ttcatacctc tgaactacaa cagcgaacat atctcctaac ggaaggtagt    115380
     ttgcaagtgt acttttgaca cattgaatgc taggaatcaa atagagctcg tcgaaacttt    115440
     accgtggcat tactatgaca gcaaaacatt tgaaacgaga aatacagata tattgtgttt    115500
     gagcataata ttgatactaa ctgacgttgg taaccgacaa tctcgcattg tgatccgaac    115560
     ctaccagaag tagatttcac tatctcttct aggctaccaa tccttcttct tgatagctgc    115620
     tccaaaagat attagatgag tattatcata ttattttgct ttgagtaggc ctccggatat    115680
     tatcgttcct tcgtaaatcc caaagatctc ctcaaaactg ccgtcctcct tccatgcacc    115740
     acgagcacgt tgacagttag atatgaggaa aatttgctcg agaattcgca actccctact    115800
     ccacgctccg gcagggaccg gcgaacagct tgatgaaaac gtcgtcaatc gcttggtaaa    115860
     cgcctacgac gattttaaaa ctttctcgga cgtgaatcca atgctaaggc tgctcgcagc    115920
     ggacccgaac ctgagagagt tcgtattctt caacgggacc aggacaataa tatctaattc    115980
     ggtgttccgc tctaaagacc tttcgccgcg tgcgaatgtt ttcgaagaca tcatttttgt    116040
     gcatgtagtc aaatggtata aactatcgca ggctagctac ctccacttag cggagcagac    116100
     ggttaacggg ccatgtcaga tgagaaagtt gtggctaatc agcagcaacc cgtttgacat    116160
     cgttggggca cgcagcatgg gcatgaatgc catttgggtt gatcgcgctg gtgttggatg    116220
     gaaagctgcc gtggttccgg atttacagcc aacagcaact gtaaatagcc tagagcacat    116280
     tgtggaggag gtcagagctc atcgggagta actctgctat gaaatggttc ttttaatttt    116340
     gatttgtcga gcgaagaggc ctacaattta tacagatccc ttggaatgca gctaagttgg    116400
     ctagaaaagc ctcctcgcga tactcctgaa gcagttactg tccttgggtt tctgtttttg    116460
     atataacctg tatttctgct gctaaggatg cgggcgccat gcaggtcggc gaacccggga    116520
     aaatgaatca aaaactcgcc ataacgaagc ctgtacgacc aattggaatg aatgtgctat    116580
     aggtcgcatt catcacaaac atgtaaggtg ctcgtcattt agaggcgctt gcgggtttcg    116640
     cggatttcca cctgcagccg ctttatttga gcccacagca gactgttctc ttgagttgta    116700
     aggtcaaaag acttcttcaa ttcctccgct ctagtttcca aaccttgcga atgcttctct    116760
     ttgcgctccc ggaaagccct ttgcgcggca cggttttgag ctctgcgctt ctacaccgtg    116820
     gtcagcaagc atccttgact tgatgcctat ttctgtgagt tcaatgggcg cggcggtaaa    116880
     taccgtaatc gattctgaat ccaatggctt cttatcatgt atcttcgctc tgctttctcc    116940
     ctgcttcttc ttcgtctctt tgttgtggat tttgacagtc ccatccgttg atttttgctt    117000
     ctcgtcgagc tcgttattat ccgtatccgg cgtgctgcca ggtagattgc cggttagatc    117060
     gaccgagccg ggaagctcga aatccgccgc agatttgtaa tccaagagag agcttccatc    117120
     atcactacag ccgaaagtat tttcatgaag ttgaatatta tcgagactgc accagtgagg    117180
     ggaagtgaaa ttctgggatg aggcatggcc aggaagaata tgttgttcga aattggcctg    117240
     agagaggcca tttttggact tctgggatgg tgtgccggat agagccccta ggagcaggtc    117300
     ttgtcgacaa ggtgaaaggt gaattctctc ctggtgaagc tggttgtaat tgtccatggc    117360
     aaataatggt atttgaaggt gataatagta ttaaatgtga ggattgttgc gtagaatgtc    117420
     gcagtcgaag cctactcaac ctggaagtaa agctgcaaca tcggaattca ttaggtaaga    117480
     ctttgccaaa cacaaagttg atttccgacg aactttcctg tcatgttctg catgcggagg    117540
     tacattccac cttttacatt cgacgaagcc aaaacaggta tgttttgaat cgccaaagag    117600
     actaacgact ctttgaggag tacggatggt cggagacaag tttataaatc taagcgggga    117660
     aaggaagaag tgatgacctc aaccgctgcc ttgtttttga atattttgct actcgctccg    117720
     gcaatgaaca ccatcgacac ttgcttacat taacctaaat tacgttaatt atcccaaaga    117780
     gctggattac taaatcaaac gtcagacatg ctgatcggtg acgaaatcca tgaaataatc    117840
     cacacttcag ggctaaaata attatgaatt atgaatgtcg aagatcttat agaaggtata    117900
     gtttcttcct tttttccctc ccacacactg acttcctctt caaaatctca atcccaattc    117960
     acagtacgca gcgcaatttc ataatgcttc ccaatcaaat cgtcctcgtc tccggagctt    118020
     ctggctttgt cgccacacac gtctagatgc tttcctatct gctggctact ctgttccagg    118080
     caccgttcga tcggagaaga cggcagataa ggtccttcgc acctttccaa agtacgaagt    118140
     taaactcatc ttcgcaatcg tttcagacat tggcaagccc aatgctttcg acgctgccgt    118200
     aaagggcgtc gacagtatca ttcacacagc gagtccggcc cagttccggg tggacgataa    118260
     tgagcgcgat ttacttgcct ggcaatcagt ggcacgaata acatcctcaa ttccattcaa    118320
     aagcacgcac cgggtgtgaa gcgcgtgatc acttcctcct tggcctcaaa tggtcgattt    118380
     gtccaaggga aattggccct gtcacatata cactgaggcg gactggaatc cgatgacata    118440
     ccaagacagg aagcgaagga aaatacatcg agtgcaacag acgaagaata caccgaggaa    118500
     taccaagcaa gtcttgaacc gccgtccaga caaagaacct ccagacgagg aaacaaaagc    118560
     acgattcgtc atcaccatcg gatcattgat gtatctaacg gtgggaacgc gaccggatat    118620
     cgcgtttgca ctgggcacgt tgagtcgctt cacatctcag ccgcaatcgc actaccaggt    118680
     cgccctatag cgattgcttc gctatgtcaa agccacacaa taccacgcat cacttaccgc    118740
     agtggtcagt tgactggata cagagatgcc gactttggtg ggtccgtcgt cactgacgga    118800
     gcttactcga cgtccggcta cgtattccaa cttgcgggtg cgccggtttc ccggtcgtcc    118860
     aagagacagg gggaagtggc cacgtctacg acccatgccg agtacattgg aaaatataat    118920
     gccattctgc atctacagtg gctccgcacc tttctggccg aaacgcagct gtatcgatcc    118980
     ccggtcacca acatcatggc cggcaaccag tccgccattg cgctatcgcg caatcccgat    119040
     ttccacaaaa ggacgaagca cttcgacgtg aaatttcact attcagcgag ccgtgctgaa    119100
     tacagacgag attgggcttc aacatgttcc gactgaggaa cgggcgacag atggtctcac    119160
     caagccgttg gcacctacgg cttttgccaa gttctgtagt ctcctaggaa tcgaagcctt    119220
     ggagactcag agacaacaca cgcgacagcg caggcgctct ttccacttta ttttcccacg    119280
     aagttttttg agtggtttta ctgaggcatt gcctgcaaac cgttaatccg gtatcgcctt    119340
     cccagcaaag cgatcctgag ggggattgtt gtgatatgag gctggtccag accaggaacc    119400
     aagccgcacc atcggaataa atcccgaggt gtctctacaa agaaccaagt tgatttccca    119460
     tcaacttggg ctttgtgtgt atatatagcc tcatgtttcc ctctgaataa atcaatcaat    119520
     tcatatatct gaactacagc aaagatcctc ctcctttgga tggaaaaggc ccgtgcgcga    119580
     tcgaaacaca ttaagccaag tctccattat cgagtagcct gtagtggata atgatccatc    119640
     aaatgaatgg gcctatattg tgttatagac gtgccagtgc tgacagcgga acgtaaaagg    119700
     tagcatggga tcccgcagtg cagagatagg gaaggtcggg tctcaccagg tgtagcgaat    119760
     taaataaatg gccctagatt tgattttccg tggaaaagca aacacgcaag gcttgtgctt    119820
     gtgctgtgag gtcaagtacc gtttggtcaa cagaagtaag ggggacgtac cggatcttcg    119880
     gatttgcatt cttcacgcat gcctgttgcc cttcagagaa attccaggaa aggaagccgg    119940
     aaaatgatgc ttaggtacgt acagcatcct tacttacttt tgagtgagga tttggtgagc    120000
     gagaggttgg ttagttatgt agaaactata ttctacagaa agggccttgg ttttattaga    120060
     agtcgttgcc tgcaggacaa atcgatttta ctctattttg cagaatgctg gtataaagac    120120
     gatttgacgg ttgaggactg aaatgcttgt ctacttttta cagaaggatc gcctaatttg    120180
     ctggggaagg gggggttaaa acagcgtctc acatgacagt atcaaaaatg cggcaaaatt    120240
     acatgtattc agccagcagg tctcattttc caattttgtt gccattcccc cacacctccc    120300
     cttgtctcct aaggcacatg caatgaggtg gctttgtgga gttgctgttt caaatataaa    120360
     ggggatcgca atgggacgac gaacaataga cgtggtcaaa cagcgacatc aagcgcaggt    120420
     gttctgttgg ggccacgagg agagagaagg taggttcggg gggacgacta attgccttgc    120480
     tttcatgccg ggtacaagta ctgcccgctt cttcaatggc ggccatttct tttgtccagg    120540
     caacaattgt ctcacggcaa gttgagatat ttacttcttt tttcaagtaa actagggacg    120600
     gagcagatag ccaagggtac tgaagcggac gttcagtatt ttttgtggga gaataatgac    120660
     atttatgtac gaatcgaagt ataggaatgc ggttaaacca agcagtctat tttgaatcgc    120720
     cttttggccc tccccttatg caatgtcaag gaccttcaac cgtttaacgc attcgagtta    120780
     acttaccaac caaattcaac gataaatcga gaatctttca ttttagatgc tcacccataa    120840
     caaatgggtg aatcagggta tctcagtatt gtctagaaat gcctctgcgt cccgctacta    120900
     aaatatatct catcgagatt tcaataagcc cacggaaata atatgactgg aactgtgcga    120960
     aatatcgtgg aaaacgcttg actaccaaat ttctgtttat caaaaaattt tttctgacta    121020
     tgtctcttga tttgtgcggc attccttccg ggccctctgg tactccagcc agttttttgt    121080
     ttccgtcctg gcttccgtcc atcgctttac acttcatccc tcttcgtcgt gcttctcaga    121140
     tgaaaccaag acgagcgatt cgacttcgtc gacctacctc tgtatttact ccatcatgga    121200
     ctgggtacaa atagccgccg aagaagatgc cgttacttcc gctaacgacc gggtagggtt    121260
     tatccctgaa aactcgtcta gctctcggcc tatgaaggat acggccgagt caggtgcctc    121320
     tcgcaaatca gagacaagct tcggatcgtg tatcaacgtt catgccttca gcgagctgca    121380
     cctttccagt cctccaccat gtttgtccgt tgaacaggac aaagtcgata gcgagatacg    121440
     accggggcac ccagcccaag tttcttcgtg tcattgtcaa cccaacggcg ccggccctgc    121500
     atcaacttcg tacagtatcg ggagcaacga aaaaacttct ttccgacgtc tagaatccac    121560
     ccactctgca caagcggcag actcttctgc tactttgttg gcgccatgca ccgagaaggt    121620
     tgcgctagtt gactcaaaag cctctctgtc tccagaacag cgccctctca aaaaacgaca    121680
     tcacattatc gaagagctcg tcgatactga atactcattc ggatgggaca tgaaggtcgt    121740
     taacggaatc tacaaggcga cttcgagttc ttgtttgggg ttttcagcgg aggatgctat    121800
     aaccctcttt gccaattccg accaggtcgt acatttctct atggcattcc tatattgact    121860
     gaagaaggcc gccagaatgt tgtacgccat gcccaaatcg cagcgatgcc gcaggactgg    121920
     caaccgtaat ctcggctacg ctacagatga ggaccagtcc actatggatg agagtgtacc    121980
     aggtctcgaa aaagatcgcc cgacctccat cggtatggtt tcctggccca catgactcaa    122040
     attgaagagg tctattctga atatgtcaag aactatgctg ctgccaacaa aaaactccgg    122100
     gtcctgcaac gcaatccgaa agtggccatc tggctggagg agtgtcgaga attagcatcg    122160
     gatctaacga atgcttggga cctggattca ttactggtca aacccgtgca gcgaattttg    122220
     aagtacccgc tttttctgac acagctattg gaattgacac ctatcgacca tcccgaccgc    122280
     atcggccttt tgtgtgcgtt gcaaggagct acaaacagct ctgtgcgtat taacgaaata    122340
     aaaaggcgga cggatcttgt gggtaaagtc gttgatcgga aatacaagaa gtttgatgtg    122400
     tgtgcaggct tgtccagggc ttttggtcgc cgcacggaaa acccgagaca acaagtcggt    122460
     gtctccaata ttttcaagga caaggactat gaggcgctag cacggagatc cgacgatgag    122520
     cgcttgcagc tgcagctcgt attgcgtgat gtggaggagt atataaagga agcggaaaat    122580
     tccatggctc ggttcaatga gttgatcacc gcaatggaag ggattgccga agtggtccag    122640
     tccaattact cggaactgga gagcaagtgg cgcctcttca aatggtcggt ttgggggatc    122700
     accaccaaag ccctaccgga acacgtgagt ggcttgtcgc tgatattctg ggacaagaag    122760
     ttattttgat ctctctttca gcctgacgtc atccgcaaga gtgtcatcgc cccgatgact    122820
     acattgatct aatcatatga cgagccacaa aggaccatga ggaagcgcga caaatggctc    122880
     ctggactatg cgcgattcaa agtggtcgaa gcccaggccg gcaagaccga caaggaaatc    122940
     gccgaagagg gagagcaatc tgtggcctta aataaaaccc tgaagaatga actggccagg    123000
     ctcaatgggc tgaccgtgca gttggccgag gcctgcctaa agaacctcgt ccagtttcag    123060
     accacgtggt atagtatgct acagacgaaa atcagagctc acgccgaatc attccccgat    123120
     gatttccaga agataatcag taactggtcc agcggctacg cttcctcgga ggcccagata    123180
     ctcccgctgg gaatatgcaa cggggcctta ctggctgaca tcgtccacct ggccaacccg    123240
     gaaatatcat cgacatgggt aaacagggat tcgcctcggc ccccttcctt agtctataac    123300
     tctaacccac gtttgttccc caccgcggag gagccgtcaa agtttttttc atgatttcag    123360
     ctttggaagc tcggttttcc aactcttcca aatggatagc aagtcgagca acagtcgtaa    123420
     cctggctgat cctacttctt ctggtcggac ggttctcaac acattgaaaa taccaaggag    123480
     tccattactg cttcagctgg ccaacacgtc tacttagagc acccaagctc tgaaaatgac    123540
     caacgcggaa ctgttttcta gtctaccgag gctgagtctc gagacttctt ttcttgccga    123600
     cgtgattagt gcctcgctca atgaaatata tcggccaact ctctggctag tcgttactaa    123660
     ggctatttct ccgccgtgcc catgtgaagt ttcgttgggg tttgttcacg ggttgtcaac    123720
     gccccacggc cgttgataca ttcggcgctt agttcaagaa cttagcatct ggccataaaa    123780
     ccatcctaat ctgcgtcgat cttgcgttac cgaacataaa tataatccct gctcaccctg    123840
     cggcatctgt cactcccaac ccccgttaaa ttgctatttt aaacacttct gtattttcgc    123900
     tacaaccttc gacggccagt tttagaacag aaatgaacgt attgaacaac gatggtctgt    123960
     gcccgttgct ttgatgatta tctgcgctga cattagtaga ctacgatttg gatctcgacc    124020
     ttcacgctat ctggcatgaa tcatctagca taccaatacc gcctccatgt ctcgctactg    124080
     atcccaatga tctgtggcag gattttcttg gcaaattcga ccctgcaggg tacgaaactc    124140
     aagggtcttc cttgatcgaa tgccttttct accccaatct cgaaagtctg tccggcttca    124200
     agtggacagg tgcagaccct ctgtccaact ctactcacgc tagcgacatt ttcctctaca    124260
     tctcagcgct ccttttccct aaagaggtga ccggatagaa tttcgatttg tgcgatttga    124320
     ccgggtatct agtaagacta taggagagga tctgttcttc ctgccgcggg ttgaaacggc    124380
     cctgggaaat ctctgtcaga tgcgcagaca gttgctagac acgatcacct ggcatgctgt    124440
     tggtgcacca ggcactagct tccgactgtc tctttggcct cgtacggaat ctctaccata    124500
     ttcaagtccc tcgacacatt ctccgctggc tgcgctaccc ccggcgctat ccttggaccc    124560
     acgatttttt gtgcataata tatcgggtaa ttttctgtgc ataatatatc tggtaattac    124620
     aaataacatt gatgtaaaaa tttggaattg tttgccaaca cttagggaac atgttaaagt    124680
     tggaccggtg actatcctat acgcttatta ttaaaagtac tcggacttaa ctgtagaggt    124740
     tgctttgcat ggagtatatc ctttggattg ggatatcaat tgtagtatat gtgtttacag    124800
     taaagtcgaa caggacagca cggaatagac aagtcttcac ccttgttttg caatgtccag    124860
     ggtgcccgcc agattgggtc tggaagggtg attccagtcg tcgagtaccc tagtcagtcg    124920
     ttcccgagat gattccagtg cctgctcaaa aaagcgcggc cgggattgct tgtcgtggca    124980
     acgctgaaca ccgtctttct cttttctcag gtgcgcacca gcttctttca agacctggtt    125040
     gctctgctct agctgctctc catcaatgtg cttggacacg cacgactccc ataggcatcg    125100
     atagagtcca acaagtcgag ctgctggaaa ggcaaacttg ggatcgtcgc gttcgaggtc    125160
     taccagcacc ttgaagatgg gttgaaaggg cttggtcgcg aaagtatgtc ttgtttcttt    125220
     ttcatgttgt gaagtggagg gctgcgatgg tcagcaagag catttgaagt cgaagtgctt    125280
     cacttactga tgagggaaca tgatcggaag attccagatt attgttcata tcactaagga    125340
     ttgccagttc gctgggctgc tgctctcctt tttcctggtc tggcgagctg tttggggact    125400
     ccattttgtc cgcaggaaaa agtctagata ggcagtactg tttccatcat gtcttggtgt    125460
     ctcttataga atatgcagac gcaggtaact atgcactggg ttttgcgatc accgagttag    125520
     gttggtcaat caacgcagac agcttttgaa ggaacttgtt tttactttta gtgggtgatt    125580
     agcagtaaat ttgatagaag ggatagtgat caatgggttg gtggggaaac taataaagcc    125640
     tcactatgtt aagggccaga taaaaacgct cattgaagag agatatattt caatcagaca    125700
     tctcttccac tttcgttgaa agcctcagaa acccagtgaa cagttttgta caacttacag    125760
     tcacccaaaa aagaagttcg gaaaaagaaa cggaaaaaga aacggaaaaa aaagaaagaa    125820
     agaaagaaat gtatcctcgt tggtcacaac ttcaaaaatt gagtgttgac aatgtttggc    125880
     caagcttcaa cgggttgacg ggtcgagcac ccgcacatcc taccgtgacc tcctcgcttt    125940
     ctgcagtcta gacggacaga cccacacagc tcaacacaac caacacaaca ctaaagcgag    126000
     gccaggggaa aaacagtcca tgatttctag ggatgggttt gtagccgctt ttcggtgatt    126060
     caacgttgag tccctcacag atgaggttgc tcgcaacatg aaatatggga atatgggccc    126120
     tgtcattgcg gattgagtat ctcccacaag cgtcaattta agagtgccgt gaaggattca    126180
     acagtcaggc aacgtttctt gaccgactca gcatcccttt tctcaacacc actcttactc    126240
     gtctctctca ctgagcatct aaaggcatca agaatgtcgc tgcaaatagt tgcggtaaaa    126300
     agaagacatg ggtctcaaca gccctcaata aggataggtg tccaacgctt tctctcaagc    126360
     ttgtgagtgt cagaagccga gaagcctaca aatacgtcct ctacccccgg caatttgctc    126420
     tgcgatttat tcacttggct ctacaaagtc gagcaggctt gtgtctgacg cactcgataa    126480
     gttctccctt gatcgagtac tggaatttat gccgtgctga catttatagg atacatcgtg    126540
     gcctagcaaa tcagacagtg tctgtaagat atgagattcc aagcagattt actgtgccat    126600
     tcacgccagc cagtcagaga tacgagattt ggttagctaa ccagttaaag agttgaagtg    126660
     tctatgcaaa gatgtctccg ctatagcagc tgactgagct gatctaatgt cccgcctctg    126720
     gatgtaccct caaagttgaa gcgcgactgc tcatgctgta ggtatgtaga ggtctggaaa    126780
     tcctgtttga aactgcactg ccttcaaaga cgcagaacaa ccagatccgt ggacattcga    126840
     ccacaatgca ccagtgcaag ggccacagct ccttgccgtt tcttcatccc tggtcttgac    126900
     catcagaaca tgtgagtcat ggaatgtcac tctgatctac tggctaataa ttgacagtga    126960
     acctttgaga gctcaccaga gtggccctga taatcctgca ctaccgtcag tgctccacgc    127020
     aaagccatgg cttacacact atttctggcc ccgtcgcttc gaacaatgca acatgtctag    127080
     gtggaagatt gcaaaccagg atagcgagtc aacaacaggg tgcggccatc cacttgcgaa    127140
     cttcgtcgca tagaaccttg agactcccat ttccatgcta aggtgagtga gatctaacgc    127200
     ctacagctgc gctgggtctg attatccgcg ccaagcctta ttcccctagc cacgaacacc    127260
     actgacatct tcacactatt gtaggagcac cccatcatcg acggtgaaat atactgtggc    127320
     gagtggccta ttccgccgga tcggagataa gaccaaggtg gcgggccgac gagcgtgctc    127380
     catcgcgtct tccgccctcg tccccaccgc cttcacacta ttatggagtt cctggacctc    127440
     tggcatcgcg acacattcat ccaccatgga agtgcaatgt ttatcgcaag tgggtccgtc    127500
     acgcgcgttt attgtctcaa caaattgtct tgtccacccc agcgcggctt tttaagcgac    127560
     agccgattgc gatgagcttg aatgcgacgt ggcatggcta gtgactgcat tgcagagagt    127620
     tgtaagtgat ccagttgtga agccgatatg atcattgcgc aaactgatcg tcccgtctca    127680
     agcgcacttt tcggggtttc catgaacagg taagctacga caactcgtca gaccagatca    127740
     gtccttgctg actcggatcg tacaacagga gaacaccctc atttctgtca ctcaagtcga    127800
     atgccacgcg aacaaatgtc ttgtccgctt gagctcccct atagcaatac gatcgcatgc    127860
     tgcctatccc ttccacgtga ctactatcga cgatgagtca ctagagggtt tgtatcgacc    127920
     tcggcctctt ctccctttct ccctatagat tttgtgtatc aggccattgt tcaatctgtc    127980
     tacctgatac aagacctgaa ttccgatgag cgtataccac tacccgaatc atacctgtgg    128040
     ctaggcattc aaaccttcaa ataccttcaa gcggcgtagg ctgctggtgt cgagtgtgtg    128100
     atactcgtcg tcctcggatg gcatttggtg tctttccaag cctggaattc cgaaagacac    128160
     agaggaatgc tgatgttctg tcctgcttca tggcaggtga gctgtacctc cgcagacagt    128220
     catactgtta gcacaagtcc acctgcaagg agaaggagac gcaaagtttc ctcgttctta    128280
     gcctacaagt tgacattggc catctcagct aaaaatcgga ggataagacc ggggcacagg    128340
     caaccaatga gagagctcac tacccaagaa tcacctcgag catacaggaa gctgcatcat    128400
     gagggctgtc aaaactgttg tggagtaccc tgttggataa atggcgcgta aatataattc    128460
     ttatgcacgc atttcctatc caagccgaag cactatgtgc agaccattta ccctgagtgg    128520
     cactgcagct gcaagttagt tatgttgacc acgcgtatcc tttgtccgtt catatagtct    128580
     cctagcatat catgcacttg tcaggaaagc cggattctct gcatccccta cctcgactgt    128640
     tctttgagag taaattatat attcgacgag ctcatcgggc tgcggaggac acataggcat    128700
     gtcactgttc gaacaggcag ccacttaaag tctttggtgt tcgaaacaac atcgaatcag    128760
     aatggttctg ggacctcttg gactagccct aggtcctgga gcaaattttc taccgtcaac    128820
     caaacctcat gtgatggttg ctttcggaag gacggccgaa gtgtctacta cgactacgag    128880
     cgaactggta ctcctgcgag gatatcaccc cacgaaaatt cgtttcagac ggcactgcta    128940
     gaccccaatc gggcttatac cgtgttcttt tagcagcaga gcatggttga ttgcatgaac    129000
     ttgggatagc acttcccgaa aggcaatggc cgtcacttcg atccgggaga ttggttgaaa    129060
     tataatctgt cgttgccgag gcatagtaga aggagccgac cgggtattct tgattgcttg    129120
     cttgtccaaa gctctcagca acatggttgt ctctgtggta aaattacttt gattcttgcg    129180
     ctctctggga tataagagct gaaatagagt aaggccgagt gacttacaat cgccgcctga    129240
     agtgatgatt ttgacttcgc aaggcacaag cctaccgcat ggctaatttt aatcaagcca    129300
     atcgttcggc acctcatcac atgcttctac acgtgggtct tgggcgtatt gcttggtcat    129360
     agttaaacca gtagatctac tatccctatc ggattgaggc tgtatgccaa cttcaccgag    129420
     tgatcagaat gggactagaa atggcttgcg aaatagaatc aatagtgatt ggtacattta    129480
     tcatgtgggt gggatggcaa gaaaacctcc gtactacgtc cgtgagacat tgatagacct    129540
     cgccacggcc catgaggccc atggattcgc actgagttac tttccccctg cctataggcg    129600
     ggcgggccgt tgaccgtagc cccgtggcat ttaatgggcc catgggtcgc ttactaataa    129660
     gcacttcagt cacatgaagt tttcataaat ttataatatt tggccacgga cgtatatgtt    129720
     ctatagtaca gagttacgta ttcgggttat ttgagtagga atgtctataa tgaatgtgtt    129780
     cagttataac cgagcttagt aagagcaatg aactaaatgg aattgaaagt gtgatccgaa    129840
     gtacatagaa atagtgatgc gactatattc ggtgcaaata tatatacaac tacaaaacat    129900
     gctgattcta ccaaatccac tcacaatata atgactacca gtcgcatcaa taaacttatt    129960
     ataaacacga catatccatt atactacata ataggattca ccttcactat gatcgattat    130020
     ctactatact agtggttatt gggggtaagg gacagtgata gatttccaaa agttgaaccc    130080
     ccctaactat ctaagaacct tacataatct gatgcgggag gtctagacat tgaccacctc    130140
     cttcaacgcc gaccattcac atcaacactc accacaacac tcacgtctct gtttgctcta    130200
     aaatttgctg gcagatgccg tataacatcg cggcaaaggg actttaccag ctagcagaat    130260
     atcaaggaga ggctgagaat acggcagtcg ctaacgaaga aagtccagtt tggatctttg    130320
     ggtgactgac atttgcgaat atctatctag ggctcactct atgtatccaa tgacaatgat    130380
     tcggaatttg aaacagatga cggagatgtt gcgcaggtct ttgcttcttc gaaaactctt    130440
     gaatactcga gtactggtcc ccagcaccac ggagaggtgc ctgcacgttg ttggggagcc    130500
     ataacaagtc cttggcgagc caagtcttgc atggctgagc gcatttttac ctgcacaggg    130560
     ctcattggct gcgagggagc acatttttac atacacaggg ctcattggct gtgagggagc    130620
     acatttttac agtcacaggg ctaggctgcg gcacacccgc aattgcggag ggcacttggc    130680
     catccgctcc gtaaatttgc ggatttcgga tatcatttta gtatccgcat cctcttcgta    130740
     gggagttgag gatatctgcg gatggtccgc ggatgtctgc aaactatccg cactacaata    130800
     aatttcgtta gtttgtccta ttggggacca tcacatgata catatgtagc tgactcactc    130860
     tttttttgat tttaatacac atatgttctg gttataacag taccagcctt tgattcatca    130920
     ctattataca taaaataaac tgaaaagtta ctatattttc agaggggtgc aattaataat    130980
     aaatcttaca aattaaatcc agagcttaga cgtggtggtt gcttgtaaat gtgttaattg    131040
     ttgattgata atgttctcgc ggaaatatat atttggtgcc ataggaagct agtggggact    131100
     ctgcacgaag tgtacaaaaa ccagcagaat ctgttaatac ttgtccacag ccatcgaaaa    131160
     tagtagtaaa agtgactacg cggtctttcc ttttaattcc tgattttaat ctctattttc    131220
     acatagaaaa attggggaaa ttcacctctc cttttaggaa cttgggtgtt tttttttaac    131280
     ctttgcggag gactgcggag aactgcagat ccctagcaga catccgcgga acatccgcaa    131340
     gatatccgca ctagtgctat agtcatccaa ttaacgtata acatagtatg tatccatcgg    131400
     gaattacttt ttctgcacgt caaagtcgcg ggtgcgactc gttcgcctgt gccccctgag    131460
     aattaagccg aaaatccttc tgtaagtcta caactctact ccttttattc tctgtgacgc    131520
     ttggtttacc ttccttttga ctaaatccac tcgaaatgtc cgaatctcaa gcatccttat    131580
     tttcagatca gttctctgac gctggcttcc ttcgatcaga cagtttccct ggtctaccaa    131640
     caaattcgcg tacggtggat tcgacccctt tgtcggaatt gaccaattct ccacagtaca    131700
     cccgcgcgcc tggctccctt gagcgcgttg gaccgagatt tcgggagttc tggactctct    131760
     ggaagagcgg tgacgagatg gaaaattacc ggaaagactt tacagattgg tggatgggca    131820
     cggagtttgg gtcgcaggaa gacgtctctg aatctacgca ctgggacggc aggaagaaga    131880
     attccgagct atgggagagc tttgaacaag ttgcacatga gaagacaggc gagccaaagg    131940
     tcatgtgcaa acattgcaat acgctccttg ttcatgcaaa ttatcgccgg aaagggtctt    132000
     ctccaatgaa gggccatctc gcaagcgagg tctgtcatta caagagatca aaagcatcag    132060
     acacgccaaa aaccaatgat atactacgga gcttagtgag tcattagcac atttgtccgt    132120
     acatttctaa tctacagact actacgattg ctattaccaa gccgcaatcc tcagccaaaa    132180
     ggacatttag ccaggaactc ctcctggaga agcttcttac gttcatcacg tgcgcccaag    132240
     tcccattccg tatcattgaa cgccccgggt tcatggatct aatggatgtc attcaagtag    132300
     cacagtctga aattgatctc ccctctgcaa ggactgcccg gcgatttcta gatataacag    132360
     tccaaaagca acagcaaacc gtcttagacc gacttccacc tagaagccga ctttcgattg    132420
     cccttggctg ttgggcctcc ccttttcgac aagcctttat ggctatcact gtttatttcc    132480
     ttaaccagga ctgggaatac cgcgaggttc ttcttggatt gagcctctcc atggacgcat    132540
     actgggagta atttgagtac aactgtctcc cagattctcg aggaacgtgg gattgctgag    132600
     cgggtattat caatcactac cgacaatgcc acaaataaca acaccatgat gatgagcgtc    132660
     caggatacaa tacaatcaca aggccttagc aatgcttcgg tcttccgcat tccttgcatt    132720
     gcccaagtac ttcagctgag tctgcaccag cttcttggaa agatgaaagt agaaccgggc    132780
     aataatcaag cagaaactga gtggtctgat gaacgtaccc actccctcca ttcaagacgc    132840
     tcaacaagag agattgtgga taccttgaat aaggtatact atctttggta ttcctttttt    132900
     cttgagctct gctagacttg ttaggtccgg aatcttgctg tcttcataaa cgcaagcccg    132960
     cagcggcggg acgctttcct tggccttcaa accgaggagc cgaagcttgt tcctgtccag    133020
     gacgttcgta cacgatagaa ttttacattc ctaatgcttc aacgtgctaa gaagttgcaa    133080
     ccaacctttg atcaatattg tacaacgcat cgatatcttc agttcaagct tgaggaggaa    133140
     gaatggcgcc agatcgatta tttgctttgt attacagagc ctttcttcat gttcacaaat    133200
     gccttatcca gaacaaaaga cgtgactgtc caccttattt ttgcaatcta ttaaaagctt    133260
     ttcagtcacc ccgaggccgc tgatcgacaa ctccaacgca agcgggtttc ctgggagaag    133320
     gtcatgctcg aagcactcac agcagcacgc accaagctgt cagagtatta cacagctaca    133380
     gaagtcgaga gatacggggg tttctatgga atggcgacta ttcttgcacc ttctaagaag    133440
     cttcgattct tcacaaccaa ggattggcaa ggccatgatt atgccaagca gtaccggaaa    133500
     tgcctggaag aggggcttaa gcggtacaaa caggagctgt caaaggaaaa tacaccggtt    133560
     acagttggag cattaacaga ctctcctggt cttaataatg tgattgagac gttgcttgat    133620
     ccccagacca gtctccttcc tgagtcggac gaggacgatg atgacgaaat tgcacggtat    133680
     cttgcaaggt ttgtcatttc tagttatctg tacccttgaa tgaccctttc tggatattaa    133740
     tgcagaacct cagggcttaa tcctgcccac cctagagcct tttggggaga gcatgaacat    133800
     gagttcccgg tacttgctaa cgtcgcccgc gacgtcttct ctattcctgc aagtggcgct    133860
     ggtgcggagc gtctttttaa ttgtgcccgt gatatctgct tctatcgcag gtcacggcta    133920
     aggcccgaga caattaggga attgatgcta catcgatgca catcaaaatt cgagcttgaa    133980
     cagggagaga ttgatttagc aaaggagtat atctctactg gaggggctgc tgcaattgat    134040
     caagaaagag gttctgttca accactcatg gacctcgatc agatgagccc atcagtaatg    134100
     aagatgatga agaagaagaa gaggaggagg aagacgacga ggacgagcta cctgctacac    134160
     atgtcgagat ccaagcagca ccagcaaggc aaaagcggcc tcgaagcagt acatctgagt    134220
     ctttaaatga cttggaactc ccagaaatgc caactgaagg aaaagagacg cagggacgag    134280
     ccggacggaa acggaggcca ccaagtctac cagatggatt tgagattgac aactgtagct    134340
     actgtatgta aaggtattta attgaagatt tggattttca aagtaagaat ttagccctat    134400
     aaggatcaga agaacgctct gtgtattata ggttgagccg cgataaacat acagaatacg    134460
     ctaaaaatac tggcaaatct tcataacata tgcacgcatg agaaagtaag ggtctgggca    134520
     tgtttgtagt gtttacatat ccgcagagct ccgcaaatta tcgcgtggag gataccttaa    134580
     gatcctcatc cgctccgcgt gaatttgcgg atggtaatat ggcctccaaa tccgcaaatt    134640
     tgcggagcgg agaggataaa tccgcggatc tttacggacg tgccgcagcc taggcctgaa    134700
     gcgaccagac caggacaggc gtgtaggcca tggctttcgc agagtactaa cggggtgctg    134760
     gatcctcggg gccactctgg tgcgatgtca atggctcact gccattcatt agcttgtaga    134820
     tcggtaagtt actccatgac ttacatgttc tgttagcaaa gttagggatg aagagacaca    134880
     aggacctgcg gtccttgcgc tcgtgcattg tggtcgattg tcctcggttc tagattgcct    134940
     cgacttcagg atcagtagag atttagacag gtcaggctaa gattcacata cctgcgacgt    135000
     ggatattcgc gcttttcccc tgggaataca agcaggggct gtacagtaga tcagctcagt    135060
     cggctgctgt ggtggagaga catcttgcat agacgtttgg accagccagc ctaaatcttg    135120
     cctctttgat cggctggctg gttaacaaag cggatttgct gagagtaaca tatttcacag    135180
     gcactgtctg atttgctggt ccatgatgta ttcgataaat gtcagtacag tgggaattca    135240
     gtactgggtc aaaggggaag aacgtatcaa gtccatggtt acctacattc atgcccgaga    135300
     aaggatcgtc gtgatatcta ttaccatata atacactttc tcgtgctaga tatatttgag    135360
     gcgtaagatg cgaggtacta gcgactcgca ctatcggcac tgtcgacggt ctgttccgcc    135420
     gccactgttt tcctgatgcc atcctccatg cgtgcagatc cggtcgcatc ttgtgtactg    135480
     gcaaaggaga tcaaatggcg ctgaccatga aagagagtgt ctcctgcctc caggataccg    135540
     agggttttaa tcatcaatcc tagtcattga cctagcatga ttcagccctt ccgtttcaat    135600
     gtggcaccgt cgacagcgaa ctttcatgca aaaatcgatc agatctaaaa acggagtaca    135660
     ggcatttaat gatccccaaa agatgcgatt attcgcttgg tataacctca atacaattgt    135720
     tgtcttgttg ttgctggtga gcgcactgcc acagatatcc ttggtagcgc acctgctcgg    135780
     gatcacttgt tctcatgtat gtcccgcttg ccgttaacat cataatgctt gcactggctg    135840
     cgtaattaac tcacgcgctt cttgaactga ggagctacct tcatatcata tctgtttcta    135900
     ggtcgatgac tgcgttttcg cttctgtttc ttcttggcgg caattagtca tttacgcaga    135960
     aacttcacat gactggtcgc aaacgtcatc attgaggtct gcatcctttc acatactaag    136020
     ccccacaacc cccgtcaata ccctttccac tttaggtgtt acttttcggt gtttccccgt    136080
     tccccaaatc tcccctctat gtcacgccag ggttcattac ttttccaaaa tggcggactt    136140
     cacccggttt cagatttttg gcaacacctt cgagatcact agccggttcg cattgccttg    136200
     cccttgctgt tcccccgctg gggaatcgtt tgctgagatt tgggttctag gtatatatga    136260
     aagcccaaag tgctgctcgg gaagagagat caaaatgcgc gtcccccgct ttttatgtaa    136320
     cctcatgaat agggttgtga gtattcaata gcactttgtg cctgcctgaa tgcagccgtt    136380
     actctcaatt aaagccacca atccagggcc ttcttaccag ggcataacaa ggcgacacgc    136440
     ttagtcactc tgggttccgg tcgtcttcaa cattttaaac aaatgtattc aataccttcc    136500
     cacaccgtcc acacctattc accgtatatc cagtacttga tgcgacaaaa tcaagatatc    136560
     gtgcttctcc gcgattagca tcaccctcgc gaagatgtgg agatttgaat ggttatagcc    136620
     ccgggtataa gttgtgcgaa tcgtaacttg cagcctgaac agttgaggaa cttgactgtg    136680
     gagctcttga atgtatcaag ttccaaactg atgtggggtt ggacatccag cttgaagttc    136740
     tgaagtttgg taatgtggag atactttatt gcagttgttt cgaattatat aatgcacaac    136800
     aattctcagc agttacgata atgcgacatt tctgagtctt ttgtactcga gcaaaagata    136860
     cattgggcag gcagcattat ctgcctgggc aaatgaatcc tacccatgcc gggtacgaaa    136920
     gcgccatccg atacaactta taccataaat tcttctatca atattgaccg agccttctat    136980
     aaggtcgggc tgaatttgct ccatgatctt atcttcttgc cataataata gaaaatgatg    137040
     ggtacgggga agagaatggc cgtcaagcat cccaacagag tcatcgccca atcgacgccg    137100
     agagtgtgaa actagtcgcc atcagccatt atgttagtac ttgggccaaa gggaaattac    137160
     catggcagtt gcaaacatag ggaatccggc cccgagccac gaccggaaga aagagttggc    137220
     ggcaattgcc gagttggagt tcatggcata tacgtcgatg atatagttca gaccctaagc    137280
     aaaacgtcat ccggttgtta ggaaagaaat ttagtgatgg aaaaccgacc tgtaagaaaa    137340
     tcaacaacac accggcaccc agtaatccac ccgatatgac ctgcggcacc cacgtgatat    137400
     tgggactaga cgtccagcca aaccagaaca tcccggcggg caacaggaga ccaccaatca    137460
     tcataggaat caaccgttcc tcagggacca cttggcccgt ctgcttgagc tttgcttgga    137520
     atctggtctt ggtgaagatg atgatgatag cgcagccggc gagcacgcca acagtgatag    137580
     cgaggaacgg cagctgcccg acgccgggat tccagccccg ctgctcctgg aacgctatag    137640
     ggtatgcctc gaagcaaagg tacagaaacc cgtagatgaa gcccatatac agcgtgatta    137700
     gagtgaggat gggctcgagg acgagcatca tgaacgggcg cagcaggtag gcgtagcaga    137760
     tgtgtttgag gccaacctcg tgctcatctg ctttggcatg gatggcccaa ttcttggtgc    137820
     ggaagcggat tttgcgcgcc cgctgctgaa ggagcgtcgg tgcaaaggtc tcggaaacga    137880
     caaaaagacc gaccgtaccg aaggtaaacg ccatgatggc tgtgatgtac tcggtccagc    137940
     gccagcccag gtacgacatg gtgatgaagc cgccgacgat agggccagcg acgggcccaa    138000
     tgaaggtgct ggctgcgaaa atggctacgg cgataccccg gtcgacagga ccgaaaaggt    138060
     ccgcgagcat gccaccgacc tgtcgaggac agataaaatt aggaagacgt gcgctgggtg    138120
     attcacattt ggaaatgagt tgggtaatcc ttacaattgc caatggtgcg ctcgcaaaca    138180
     gtcctccaaa gaaccgacag acgaaaatgg tttgtagatt ctgtgccaca gccacgggaa    138240
     tctggaagat agcgaaggtg taaaatccga ttatcagcgg cttcttcctt ccgtacaact    138300
     cggataaggg gccgaaaatg atgggcccga aagcgaaccc cagaacgaat aggctagttc    138360
     ccaacaccat cacttcttgc gacacgccga atctctccgc ggtgacagat gatgcagtgc    138420
     taaacacaga ggacgcgaag gtgacagaga cggtcatcat gccgagcacg atggtaataa    138480
     gccattttcg gcatgtcgag aaattttggg ggttttcctg gtaaagcgaa gtgagcgggt    138540
     gccgataaag ggcagaagca tgttaaaagc aggctgaaca cttactgggt cgtcaggtcc    138600
     gtcccattca attaggttcg gatctttagc ggtttccttg tcatgctctc catgtgtctg    138660
     tttattctcg aggcctgcat ctagggaggg gttgtcgcga gtatttgatg gtgttgagct    138720
     tgtagagtct ggataactgt acaatgccaa taatgagcga gtttgtgtta agccttggca    138780
     ttctggatca ttttgcgcgt actgtgaaga atgtccttgt tgcactgtgt gcgggtggtt    138840
     gtccagtccc atcgcgttgc tcgtgctatt ctaaatacgt agaacgggta attcgatcag    138900
     tcggacctgc agctatcact ggcggtgcag caccacttca tatagcaagt acgaaggttt    138960
     gcctcaaaaa gcatgacata accgggcgca agcaaatatc aaggcattac ctcaccatca    139020
     catacgttca ttattacgta tcattctcca ccagttagcg ttaagagtgg agtaagacct    139080
     cggccgacgg ttatatttgt tgtaattcag aggtatgatt gattattatt tcagacggaa    139140
     acatgaggct atatatacca cgagaaaacc aagttgattg gaaatcaact tgattcttcg    139200
     tatagataac tcgggattaa ttccgatggt gcggcttggt tcctgatctg caccagccct    139260
     catatcacaa cattccccct caggatcgct ttgctgggaa ggcgataccg gattaacggt    139320
     ttgcaggcaa tgcctcagta aaaccactca aaaaacttca tgggaaaata aagtggaaag    139380
     agcgcctgcg ctgtcacatt tgttgcctct gagtcttcaa ggctcgattc ctaggagact    139440
     acagaacgtg gcaaaagccg ttggtcccag cggcttggtg agaccgtcag cggcctgttc    139500
     ctcagtcgga acgtattgaa gactgatctc gcctgtattc agcactgctc gctggcaatg    139560
     gaattttaca ttgaaatgtt tggtccgttt gtggaactca ggattgcgcg aaagggcaat    139620
     ggcggactgg ttatcagcca tgatgttggt gaccggggac cgatacagtt gtgtttcggc    139680
     caggaaggtc cggagccact gtagatgcag aatggcatta tattgtccaa tgtactcagc    139740
     atgagtcgta gaggtggcta cttccccctg tctcttggac gaccaggaaa ccggcgcacc    139800
     cggaagttgg aatacgtagc cggacgtcga gtaagctccg tcagtaacga cggacccacc    139860
     aaagtcggca tccgtgtatc caatcaattg accactgcgg tatgtgatgc ggtggtactg    139920
     tgtggctttg acatagcgaa gtaaccactg cagggcgacc tggtggtgcg attgcggctg    139980
     agacgtgaag cgactcaatg tgcccagcgc aaacgcgata tccggtcgcg ttccgatcat    140040
     caggtacatc aatgaaccga tggcggttgg gaatcgtgtt tttgcttcct cgtccggagg    140100
     ttcttcgtct ggacggcgat tcaagacttg cttgggattc atcggcgtag tcttcggctg    140160
     acaggtttcc atgccaaagt cggagagaac cttttgggtg tactggtgtt ggtgaatgga    140220
     cacagatcca tcggcctgga agtcaaattg gatgcccaag aatgaacgtg gggtaccgag    140280
     atcattcagt tggaactcta attccaatgc tcgttgcact tggtctatct tatacgagtt    140340
     tgctgcagca acgagaaagc catcgacgta gacacatatc acgcaattgg atttgtagaa    140400
     cacgcagtcg tccgattgtg ccatggtgaa gccacgagcg gctaggacgc gttgaggcat    140460
     tggtaccaaa tccgccgggc ctgcttgaga ccgtataggg agcggcgaag tcggcacacg    140520
     tatcctggtt cttcaaaacc ttcgggtaac tccatgtaaa tggacgagtc tatgtcgccg    140580
     tgtcactgct tcaggacccg tgcgagaact tattatcagg ggccaggcac tggagttgtt    140640
     gaaatatata cagacctatg cggaggagta tcacctgttt aaaaacctgc gggtccatct    140700
     tgacattggt aggtatatag aaagactcaa ccaaggcaaa gatgatgaga tgggcaaatg    140760
     atgttgttct cctgggaggt cgcgcatagt cccttgctgt ataccagcca ttttctgcct    140820
     aatttggctt caaattgagc aactctcttt ggagtgttcc ttgtatgtca catactgaag    140880
     atgctcaatg ccgttttgcc agtaatggag acattaccgc tgccattctg atgttccaga    140940
     cgttcccgcc acttgtcttt tgagctacag aatgcatatc gtgcagtcca acaactttag    141000
     gtccaggagt atgcttgtat atacttgctc cgtcgtggca gcccacaatc tttgggaatg    141060
     cggaggcatt caacattact ttcgcatccc aacgctgcct tgccgattaa caggagtata    141120
     cttgttgctc ggtttcatcg ttcacatggc agagagtatg ttaggttgga cccattcgct    141180
     catgtaaaca gtctactagg attccaagat cattagcccg tggtctttac tttgggtagg    141240
     taatgtgaga cttaacagac tggttgcgtt atgtctccat tagacagctt ccacctcatc    141300
     tggcgctcgg tattgggccc ccttgtgcac gtttggcaat tgggtaggaa ggcatctcgt    141360
     cgtgtactga taataagtcc atctaggttc agagatatgt aagtgagact gggaaactcc    141420
     acggctatga gaagatggaa atgggaagta agactcgaga ataataggaa gagaacctcc    141480
     cttgagagtt ttcactcgcc gtcaatcgag aaaatactct tgacttcctc ctccacagca    141540
     agccttgtat cagtatttta tttgctggct gtacaggcaa gttgtagtag cctaaaagga    141600
     tttcagaagt tcctcgcttg cataggatgt gatccgtgga taaagatgcc ggttggtgtt    141660
     ttctgttatg catgtagact ctttaaagga agaaaaggcc tcgattcgtt acggttgcga    141720
     tatgttgttg aataatccag ggaatacgag gaaggaaggt cggggaaagg agaaatgtat    141780
     cactgactgt ctattttagg taaggcaaat ttgggtcctc tgctctccac cttatcccga    141840
     cgcgagcacc tgagtattct ggccctcctt gtctcctgcc accaccagtt catcccaact    141900
     agataaaatt aatgcccgtg ttgcaatttc actttctctc agtttccttt ccggtaagtt    141960
     cgagctcacc gaatcctcca aactgtacct accaaaggtc ttcgggctca agcctgaaga    142020
     ctagccaccg agatactttg ctactagaag ttcctaaggc tgatttgaaa cgcaagccgg    142080
     tattgcatta tcctagttcg aacaatagca atcttcacac cgaccaaacc cttggcctct    142140
     cccatccatc ctttcgttac acgattgtcg tgtatgaatg ctcgagcttt cgaccaaaac    142200
     accgcaaaaa gccagtaaca gcacacgata taaatatact gttctttgct tatccaccac    142260
     cggtgcggag ggtctgaagt gggccctttg cccctgcctt tattgcaagg gtccttatca    142320
     gaccaccatc tacgttctta gtgaacacac agccagatat tttgtgaagt gcaggcccta    142380
     gcaattatac taccgaggaa ttacgaggaa agtaactcct gccgtgtgta cgttgtcacc    142440
     aaataggttc gacaaagatc atggtagacg acgaacttaa tgccaagctc aagcaagtca    142500
     ttgagatggc cgtcttctct caaatgttag agatggatga tcacgaagag cgtacgttca    142560
     gttcgtcggc actctatgga ttcattgaaa caagcgaaaa caccgttgaa gatatggacg    142620
     aagcattgta agtcccaata atctacgtag atgtcgtcta attagcacga aatgcaagaa    142680
     attaatcttt ccattgaggt tatcgctgat tcgatgatct tcattacttt cagttcaaaa    142740
     ggagacttac aacacttggt ttctctctgt gattccctca ggagatttgc cagcgcgacg    142800
     ggcttctacg aagttagaga gtgctgtgga aacttaaaag aaggaggtgt gatgagcagc    142860
     ggagatggtt ccgcttcagt gggtgttgag gttttctgtc ttagtcgcat taaaggcgga    142920
     attggcactt tgagggacag tatttgtttt gctcgcaggg caatcgattc cttctacaaa    142980
     ggcaatgtaa agtaggaagt cagagagcaa gacccgccat gaattggatt cgaaaaagag    143040
     aaaactttga cccgctaagc agcaaccacc ttcttatcgt acggacaacc caggctgccg    143100
     aaatcgggag ccaatccgaa ttcgcgaatt cgacatatat ggtcaataca ctccgtaatc    143160
     gaataagtca gagtatgaag ctcaagatgg agcacatggc cccgtcaaga agagacatgc    143220
     tatgcgcgag aaagattatc ctaagaggct tcagcaggca cttaaaatgc ggtcaagtga    143280
     taattgacgt atacagtacg accggcacca ttaccattcc caccttgatt aacataatgc    143340
     cgcaggtcaa tatgatgagt gaggtaggtt tatttcacgg gtttcgctta tcaaccctta    143400
     ccttcatcct gcgttcggac ttctgcgcga agaagaggaa tgctaataag acaatacagg    143460
     tttcgagaag acgaagactg caataaagaa aattgaatac ttagaaaggg agtttgaagc    143520
     tctcaaaaag aaggtggagg tcctcatgaa gaagtgggat gctgtgggac catttttgga    143580
     agcacagcgc aatgtaagaa agaggggggg tgtccaccac gccccgcccc agaatgagct    143640
     acttttgatg gcctactttt ccttacaaac ccgctatctg tcggaaaaat aacacaatgc    143700
     aaataatatt tcactcttcc ccttttcgat ctgactgagc gttctggatt tgagaagcac    143760
     atagtagcta actgatgcat tattgcattg taatttgacc atgatagtcg agatgtataa    143820
     catgaatgag gatactgtgc aagataaggc gaaaaagaca cgttgacaat accgagtata    143880
     ttagagaact ggagggcgat gatatagtaa agatagagta gggctgtgaa gaatgagtca    143940
     gcaggtatta caaataagaa caatcgcaga attttatgat ggttttcgaa aaatgaggga    144000
     ggtggagtcc ataaacatta gagaggtgcg acgatagggt catgcaaagg aatggactct    144060
     actgcagggt tgctgagatg atatagatat tgaatttcct gattagaatc aaagtatgtt    144120
     catcgcttga tcggactagc cggccgatat tggccaacat tggagcagta ttctgagtgg    144180
     cttgatgtaa aagacaggtg atggttgacg atgtgctctg cataaatatc catcagcttt    144240
     ggtggccgta aggacttcaa aaactgaccc ggggaacatg tgagccgccc aggaatcaca    144300
     tagccccagg aaatcgtacg tggcttgtac actctccatt cccactttca caaaatcggt    144360
     tacgttcccc gttggcagct ctatcagccc cggaaaggca aatcttggcc ctgggagttc    144420
     tcttgctccc gtttctgggc gcatacaagc accttctagg agtcaaatag acaccaggaa    144480
     aaccgatgta gcttctgggg cctttgacct ccacttcgag gagccaaagt catgttcctg    144540
     ttgacagcgt tattaattcc tagaattata agtggttcct ggggctttag ccaagccttc    144600
     tgggggtggt ccaatgtctc atatttgtgg gcatgcctgg tgaaggtgtc ttgtgagcgc    144660
     tctcgcgacc tcagaaggca agatattgac tataggatcc agaagtaggg tcctaggagc    144720
     gcaacatctc ccaggtctag ccaatatgtt tccagagcca gtctgtattc tgtcaggaac    144780
     gtagagcaaa gatcccaaaa gtagatcttc attttcctgg agattggtag aagccccagg    144840
     agttaagttt tatttcccag gggatagata actcctagaa atgcttttga gtttcccagg    144900
     ttcaacatat tgattcccag agtcaatcta accagcacaa gagtttgcca gagtccctcg    144960
     ccggcccgag atgtgttttc ttctgccaac aatctccgtc ttgacgcgac accacgctcc    145020
     actgagataa atccatgtct acagttcttt ggccaccacc gttaggtatg aacaaaaaga    145080
     actattatct acccgcacgg tttcaatcta agacatatca aaaattaagc gagactgcca    145140
     acagcttttg ggggtgcatt ggcatctagt acttgcaaag atgaaacggt cgtgtggttt    145200
     tggtgctctg tgagtttgaa tgttcagaac ttcatttgta tcatttttaa gcttactcca    145260
     agctctaaat cacggctatg ctctctgttg ctgagcccaa tgccgagtgc ctggccatat    145320
     ggaatcacga gtgattgaca gtcgcttcgc taatatctca ttcccgtcac accgctgtaa    145380
     actaagatca cctccgagtg gaaactagtc gtgctgaccg gcggggcagt gcagacgtag    145440
     aagggcctcg tggtagatga gcccctacta gcctagccga gcgacgggga ccattctcca    145500
     cactctgctc gactgatctc ccttggggtc ccactgtgat ctcccttggg gacccactga    145560
     ccgctgacgc ggctgactct gacccgggtc atttggtgat gaattcctga tagtggcaag    145620
     ttctccttcg ggagatgatt cacttaccgt gtggatatga tgtgtctagc atccgacgat    145680
     tggactcgta gtgggcgaat caaggcgtct aaaggccctt cgtttcgact gtattgatca    145740
     gcatcttggg tattgaataa ttggaatcag ccctactaac cacacacagc atgacgtccc    145800
     aaaacctgta gttcattttt ccagccactc ttccgcgcag gccaggtggg aaagcgcctt    145860
     gcactgacag cgcaagctca cactctcatt tgcaagatct tcatccttgg ccagacaaaa    145920
     tacacagtgg atgtcgtcga cctcgtcgct cagggtgaga tacttgagcg tcaagtcttg    145980
     gacgccagcc cagacgttag cgaccaatgt caggacagct ggtcgagccg gtgaaacgtg    146040
     ccatggaaca ctgttggtcc gcagcattgt ggcagtgaca atcgaattga tagattgcac    146100
     tggctcaggg ctggttgaca gggacaccgg cgggtcttgt ctgagcccgt gaggaggtga    146160
     ccggtcagtg ttgtctgatg cagggcgtcg cctggaggct gacagtgtct gacgctggcc    146220
     cggatgtaca atgtctgatg gagagtctat cctggagcca tgtagtactc gcgcctggtt    146280
     gtggacagct gcttcatacc actgctggcc aacttagtcg gcctgtcgtg gtcgatgcca    146340
     tcccgcgcag aggaattcct tggcgacatc acagagctcg gtttgcaaag ttgacgtgtc    146400
     aaacggctct ctagcgagag tggtcaactt ttattggcct attttggtgt cttcaatctt    146460
     gacagagctt ttgcacggct cgcctttttt tgtcatcccg cacaggacac aggaccaccg    146520
     agagggatcc cgcaaacaga aaatgggttc caaggcatgg tagtcattga gattgtcttg    146580
     aaaggcagaa aatactttgg atgggagttg atgttgggca atctccgcag tgttccctcg    146640
     ccagctttat atgccatcgc cgtagcctcc ttacctacat ggctgcgtgg ctgctggcat    146700
     gcaacgcctt ccttgaaaca gttggtacgt cgaagaatgc attcggatgc agtatgcgcc    146760
     ggtataggcc gatcagtggc ctgcgagaag ggatatcatt ccacatcact gctgcccaaa    146820
     tcagctgcac ttgtggctgc agattgcggt gaccatgcat tggcgaacag gttggctgcg    146880
     gcgggacgca gcaaagtcga caaatgctag gttaaattct gggttgccta tggaagtttc    146940
     gaagtgcgtg ttagattgtt atttgcttca acacctatgg cgctagatcc gaggtgtggg    147000
     cacgtagaga ctagattcgg ttcctagggc catcgacaac taccaggaac agctttggtg    147060
     ttcccaggag ctagagtcca aggattcttt aacccgccta aacattgttg tcaagacttt    147120
     gatgctgccg cgtgattgct acgcacctct cagcggagtg acgggctaca ccctaggtga    147180
     ccgcggaatt tagctgaggc aagtatataa ggacctctcc acgtccaact ttcacacctc    147240
     acacctcaca cctcaccctc atctacaatt tatttgcttc ctagttctaa tctgctgtcc    147300
     cactatggtc agttccaatt ttttcttact gaagttacgg atgagctaac aaaatacagc    147360
     caaatatcag aaacctcccc aacgagcttt tgctgtgcat tgtgtcgcat ttggacggca    147420
     gtgcattatt tgccctcaca acatcatgca aaaaccttta ttttagactg cagcccagca    147480
     tctggaaata caacatcaga tttcagaaca gcaatctgtt gcacctggcc gtcaaatatg    147540
     acaacgttgg ttttgcggaa gctttgctcc agcacaacgc caatatcaat gcattttacc    147600
     gaggcaaaac tcctttgatg cgggcgttga aatactcttc cgctgctgtg cgcgaactgc    147660
     tgctcagtcg tcgagatcta gacatcaaca tccaaaatca agcgcgggac agcgccctgt    147720
     catatgctat ccactacggg agtttctcca tcgtcaagag cgtgctagaa caccacgccg    147780
     ccagagtgga cattaaacac aaaaacgggc gaacggcgct tcacctagca gtcttcgcag    147840
     gaagaatagg attcgtgcaa ctgttacttt ttagtggcag cgaccctaac ttggaagatg    147900
     attcaggcca gtcggcgtgg tcttgggcat gtcgaatcaa tagacccgtc atggaaatga    147960
     tctttaccaa tggccccgac cctgaagctt atctaggtac tcgaaatgca caggattccg    148020
     agctacctct tcatgaggca gtgttgcatg gatcgataga tgctgtcaag tggcgtctta    148080
     gacaaaaggg tctgaacttg ggcattcagg accggaaagg ctatacgccg ctccatctcg    148140
     ccgttcaaag cagacgcctg gaagtggtca atttgatcct gagccacccc cttgccaacg    148200
     tgaactgcaa agacaaagat ggcaatacgc cactttggct gtctagttac tcgccatgcg    148260
     acgagataac cgaaaggctc ttggcggaga aagacatcaa cgttaatttc attggaggcc    148320
     gtgggatatt tgaggccccg tctacatctt taccatgccg cgacgagatt ggatactata    148380
     cttctacgac ggctgcttgc aatgacaggg attgctctaa atctctgcgt tgcaggccac    148440
     tctccaattt ccgttgccgc gtatcacgga cacgtgaaca tggttgcttg tttactgagt    148500
     aggaagggcg tggagattaa tggaaggggt ttaatagatc cgcccatttg tcgagcggtt    148560
     gcacacggcc atctcgaagt ggtaaggctt ttagtgcaac aaggcggcgc acgtctgaac    148620
     atcaatgaaa gcacgatcga aacccacgac actgctctct gcatcgccgc tcgtaatggt    148680
     gaattagaga tggtccaggc actactacgc catgaccaaa ttgatgtcaa cctcaggaat    148740
     cgatggtttg aggatccatt gatgttagca gtcaagagtg gacatttctc gattgttgat    148800
     acacttgtgg tgaatcccag actgaaacac ttcagtttga agagatctct ggatttagcc    148860
     agggacgact gcatccagag ggccattcga accagaatgg aagatgacaa tagtcgtcaa    148920
     ggattgttga agcggtctcc gaggagatgg tttggtcgcc tgtaagagct ggtgacatct    148980
     acttcaggta gccctcgagg tgccatgcga gaaggccgag ccaatcgaca ctttctccgc    149040
     tagctacaat gcccatattg tcgccggatc cgtagtttat tgtttataat atattaggtt    149100
     attgaaattg ggattgtccc agaacctgcg ggattatcca cagacacatt ccacgaaggc    149160
     tataatatgc ccttcctaat gttaacctcg aaaaaaaata agcttctttc cacgcgatga    149220
     ttctcttaat tgcgatatgg ttggatattt cctacgtaaa agtgagacat aggacgatca    149280
     agaatgtaca atccttcacc cttctcttgc catgtctggc agccctgcca gattgagtct    149340
     ggaagggtgg ttccagtcat cgagtaggct aatcagtcgt tcccgggatg attccaatgc    149400
     ctgttcgaaa aagcgcagtc gagctagctg cttctcgtgg tgcggctgaa gaccgaccct    149460
     ctcttttctc aggtgcgtac gagcctcctt caatatctga ttgctctgct gtagcttttg    149520
     gccatcgatg tgcttggaca cgcacgactt tcataatagg tggaaagggc tcgatcgcca    149580
     aagtatgtct tgtttcttca tcgtgttgca aaagggaggg ctgcgatagt cagcaaaagc    149640
     atatgaagtc gaatggtttt acttaccaat agagggacat ggtcatgggt ttccagtgaa    149700
     ttgtccttat cactaaggac tggcaattca ctgggctgct gtcctccttc tttttcctgg    149760
     cctggcgagc tgtttgggga atccatttgt ctgcaggaga aagacaagaa gttgggcaat    149820
     accatttcca tcgatccttg gtgcctctta tagacaatgc agacgcagat ggctatagac    149880
     tgggttttac gatccccaca tcagtcattc aatgcagtca gcttctgaat agaatttgct    149940
     tttattctca gcgggcgctt ggtagtaaat ttgagaggag ggatgtcaac gagttggccg    150000
     ggacaactga tcaagcctga cgatgttgag ggccagatat ggacgcccat tgatgtgaga    150060
     gatatctcaa ctaaacgcct cttccacttt cattgaaagc cttagaaact cggcaaacag    150120
     cattgtagac cttagagtca ctgaaaaaag aagttcggaa aggaacgaaa tagaaaaaga    150180
     aagaaaagaa atgtatcttc gaaggttggt cacaacttca aaaattgagt gttgacaacg    150240
     tttggccaag cttcaacggg ttgatgggtt gagcaaccgc acatcctacc gtgacctcgc    150300
     tttctgcagt ctaggcggac agacccacag ctcaacacaa aatcaacact aaagcgaggc    150360
     cagaaacaaa ggtccatgat tcctagggat ggaattttag gagctttcgg tggtccaacg    150420
     taggggtgga ttcgaataga gtttttccct attcgaattc gaaaagaatc ttgaagggtc    150480
     tattcgaatt cgaaaacgtt ttgcggcatc actgtcgtat tcgaaatgcg gatattcgaa    150540
     aagttattcg aaactccgcc aagaaattga ccgcgtagga taattggctg acgccccaat    150600
     gaatataccc gtgatttagc gtggtttcgt cgcgtactct ttatttacca caaacccctt    150660
     tttcatatgg accttgttac ataatgttgt agttcagagg tatgaattgt cttattattt    150720
     cagagggata catgagccta tatatacaac aattagccaa gttgattgga aatcaacttg    150780
     gtcgtctgta tagacacttc ggagctaatt ccgacagtgc ggcttggttc ctgatctgca    150840
     ccagcctcat atcacaacat tccccctcag gatcgctttg ctggcaaggc gatactggat    150900
     taacgctgtg caggcaagcc tcggtaaaac cactcaaaaa ccttcgtggg aaaataaagt    150960
     ggaaagagcg cctgcgctgt cacgtttgtt gcctccgagt ctccaaggct tcgattccta    151020
     gaagactaca gaacttggca aaagccgtag gtcccaacgg cttggtgaga ccgtcagcgg    151080
     cctgttcccc agtaggaaca tattgaagac caatctcgcc tgcattcagc acggctcgct    151140
     gatagtgaaa tttcacattg aaatgctttg tccgtttgtg gaattcaggg ttgcgagaaa    151200
     gagcaatggc ggactggttg tcagccatga tgttggtgac cggagaccga tacagttgcg    151260
     tttcagctag aaaggtgcgg agccactgca gatgcagaat ggcattgtac tgtccgatgt    151320
     attcggcatg tgtcgtagac gtggctactt ccccctgtct cttggacgac caggaaactg    151380
     gcgcacctgc aagctggaat acatagccag acgtcgagta tgcaccgtca gtgacaacgg    151440
     agcccccaaa gtcggcgtct gtatacccga tcagctgccc actgcggtag gttatacgat    151500
     gggattgcgt ggctttgatg tagcgaaaca atcgctgcag agcgacttgg tggtgcgatt    151560
     gcggctgagc cgtgaagcga ctcaacatgc ccagcgcaaa cgcaatatcc ggccgcgtgc    151620
     caaccatcag atacattagc gatccaatgg cggtcgcaaa acgcgctttt gcttcctcgt    151680
     ccggaggttc ctcctctgga cgatgattca ggatttgctt gggattcatc ggcgtagact    151740
     tcggctgaca actctccatg ccaaagtcgg agagcacctt ctggatgtac tggtgttggt    151800
     gaatagatac ggacccatcg acgtgatagt cgaactggat cccgaggaac gatcgagggg    151860
     tgcccagatc gttcagtcgg aactctgttt gcaaggctcg ttgcacttgt tcgatttcgt    151920
     gcgtgtttgc cgcagcaaca aggaagtcat ccacataaat gcaaacgacg caatccggtt    151980
     tgtagaatac acagttgtcc gattgggcca tggtgaagcc atgagaagcc aggacgcggt    152040
     ggacgcattg gtactaaatc cgcggagcct gcttcagtcc gtacagtgag cggcgcagcc    152100
     ggcatacgta ccctggctct tcgaagcctt cgggcaactc catatagata gaggaatcga    152160
     cgtctccatg aagaaatgcc gtgacagcat cgaattgttg gagtttccat ccgcgcaaca    152220
     cggtactggc gacaatgcag cggacggagt ccatcctgga cacagcagca aacgtgtcgt    152280
     gacagtcaat cccatgtttt tgccggtagc ctttgataac cagacgcgct ttgcgcgttc    152340
     cgttggcttt ggtcttgaag acccatttgc agccaatcac atgattcctg gctgggacgt    152400
     cctctcgccg aaccttttcc catgttccgt gttcgagaag cgacgcatat tctttctgga    152460
     tggcggccca ccattctagc tggtctgggc ctgacacggc ttcgtgaaag gtcgccgggt    152520
     cgacttgtgt agccggtgtg gttttcaatg tgcctgccga gtacaccttg cctagtgatt    152580
     ccaggagacg ccttgacggt cttcgtctgc gaccatagat cgaataccca agatccgatg    152640
     tcaagtcggt ttcttgttgg cttgggttga ccactggagg tgtttcctcc tcacgcccag    152700
     atggcgtttt ctctcgctca ttcagcggag gtaatggcga tgcaggtggt gttggcagtc    152760
     cgctggttga acttggcatt gatggaaaga cagctgatgg aggagcgttg tccgggaggt    152820
     cgttgcctgt ttccccctcg atgagtggcg ccactggggt cctctcatcg aactcgacat    152880
     cacgggaaaa gacggtcttt ccggaatgga cttcatacag cttgtactgg ttcggttcac    152940
     aataacctag caatcggcac tcggatgatc tgggtccgag ttttgctcga tgctccttcg    153000
     ggatcaacac ccatgcgcgg gagccgatcc gtcgcagatg cagcagcgag ggcggtttcc    153060
     cgtataatac ttcgaacggt gtcttcttct gtaaaatcga tgctggagcg cgcagcttca    153120
     gatagactac cgtttctaaa agctcggtcc accaggaagg aggaagtctc gcatcggaca    153180
     ggagcgtgtt aatccgctcc cggatagtgc gattcgtgcg ttcggccaaa ccattctgcc    153240
     ctttgtagta tggtggcgaa gtgtcaaact cgactccctg ggtctcgagg tgtgttccga    153300
     tcggcaagta ttctctcccg ttgtcggtga ggaacctctt gatctgggcg ccgaactgac    153360
     ggtgcgccca ggcctcaaat tgtcggaact tctgcagcgc ttcatgcttc catctcatgg    153420
     catatgccca cgagccacga gaataatcgt cagtaaaggt gatcacgtac ctggagccat    153480
     ctttggcgat cggcatctcc atgatgtccg aatggatcat ttcaaagatt ctcgttgaat    153540
     gcagacgtgg ccgtcttgca cgggagttcc tcttctgatg ctgcttaccc gacatacacg    153600
     ctgggcactg cggcgttgcc agcagctgcg cctgcgttag cggtcggtac ggagtgccgg    153660
     tctgcggagg accaccctca agtctccccg gttcagatgt cccatccgag cgtgccacaa    153720
     cgcttccgag gcctggtcca ctcctttgca cgcatcttct tcgagtatca cagcttcacc    153780
     accgagttca gaggttgacg ttgcgcattc tgcgtccctt gactcctgag ggtcgtcgac    153840
     gtccatggcc accgcctgcg gttccaggga atctgcatgg ccacgggtcg ccggcgccct    153900
     cgccagttgg actcgctctc gagatcttct gctcacatgg caccgcagga tcaacagatc    153960
     ctcctccgcg tggtaggcgg tccccaccgt ccgtcctcgg cgttgcacaa agacgttctg    154020
     cgggtgcgcc accaccgagt agcggtctcg caataacttc ggcacgctga tcaggttcat    154080
     cccgacgcgt ggcgcgaagt atacattctt taacaccagg ggttggttga acttcccccg    154140
     gagcgtgagc ttcaccgtac caatcccttc ggcttccact ggatcacccg ccgtgtccaa    154200
     catctcgcgg tggggccgca gactgctgaa gcagctccgg tcccagcaga tgtgccttcg    154260
     tgctgagaat gcccgtagtg agaggatgtc agtagccgcg cggtctaacc tcatacatat    154320
     aatggaagaa tatgatatgc tagatttttg gtcactagta aatcaaggct cattgtttaa    154380
     gccgttgcct aatctaagag atctctaatc cgatagtcaa aacgttcatg cgaaggcaat    154440
     ggtaggcgtg ctgcttttcc tgctgtgctg tgatgagcat gcaaagcagt tctcgccggg    154500
     gaagcgtcca gtgcagtccg gtcatccagt gcagttcggt catccagtgc ggtctggtca    154560
     gcctgtccta tctcaagtag tacttttacc acagctcggt agccttgacc cgaagcgatt    154620
     gatagcggcg tgcgaccaac acagtccttt gaattcacat tgacaccccc gctcttgaga    154680
     aacatctcca ccacatcttt acggccatat tccaccgcat ggaataatgg tgtgcaacca    154740
     ttagtatcct gcgactccac gtccgcctgt ccagtcctga gcaagatttc gagtgcctgt    154800
     gtatggccat tttccgctgc ataggataat ggcgtacggc catgttcatc ctgcaagtcc    154860
     acgttcacct gttcagtctt gagtaagatt tcgagtgcct gtgtatggcc ccttgatgca    154920
     gcatgggaca atggcgtgcg gccatgttca tcctgcaagt ccacgttcac ctgttcagtc    154980
     ttgagcaaga tttcgagtgc ctgtgtatgg ccccttgatg cagcatggga caatggcgtg    155040
     cggccatctt catcctgcaa gtccacgttc acctgttcag tcttgagcaa gatttcgagt    155100
     gcctgtgtat gaccccttga tgcagcatgg gataatggcg tgcggccatc ttcatcctgt    155160
     gtgtccaggt ccactgggca tgcatcaagc aatatttcca atatcgtagt attgttgctc    155220
     aatgcagcaa gggataacgg cgcaaaacca tgatgaccct tctggtttat cttcagccgt    155280
     ttagtgcctc gaagcagctt cactatttcg ttgtgaccgc ggaccgtagc gagcaataag    155340
     ggggtcactc cgttatttgt gatcacatta acatcgcctc ccatcgagag gctctttaat    155400
     gcagttgttg tgctaccttc tcgcgcagcc cataagagag cagaactttg ggatgttctt    155460
     gcattctgct ggtatagata tgaattaagc gccgaatgga gtgtgcggct tgtttggacc    155520
     aacgagttga ttgagttttc tgacgaaaac cctgccacta ataggagcaa ttcctggggt    155580
     aaatcaacga ggcccatctc gagagcaggt acagcttttt ttgtttttgt tttctttttt    155640
     aaactcagaa aaacagtaga tggaatggtt cgttcatccg ctagcggttg gggcaagagg    155700
     gtggattggt ggactaggaa gaagcagaag ggatgacttt ttgtaatttg gagcgcagag    155760
     ccggaattta actaacttac taacgtattc ggtaacgtat ttcacaagcg agcggcgcac    155820
     acaagcgagt ggcgcacccc acccaacctg ctaatttcaa atgcatttat ctcaaccaaa    155880
     acgcccttaa attaaataaa ctaaaatcat catctatctg gacatgtctt ctcctatgtc    155940
     ccggcttcct acatattcca caccctcggg gggctttgta cgaggttgta aagccgattc    156000
     tctatgtata ccggggccgg gggttggtgc ttcaactgct tccacaggct gcgtaattaa    156060
     tgcagatgct tcctgaactg agaggccttc ttccgctggt atttgccttc gggatctagt    156120
     gcgcttttgc ttctgcttct cgttggccgc gcgtaattcg ctcacttctt tctctccagg    156180
     aatgcggcgg attgcatagt gatctagcag gctttcaaaa cctggttaat agcggaattg    156240
     agcgggcttg gggggctcct tgatcttgta ccaagcaatg ctttgattga cgaagcttgt    156300
     ttatgcaatt gtatatagtt cgagggtgtt ttttggattc caatcactac cccggctcgg    156360
     tggggggggg gggggggtgt ggttcgaagc cgaatatcaa gctttgaaat cacgtcttcc    156420
     ggtgcaaaag gtattaaacc agcagatcga aagctatttt tgatagtctc tgatttaaaa    156480
     acttcaattc gtgcgagggg gtatgcttcg aggaagtcaa atttgtcgat atgattgatt    156540
     ccgttccgca ttttcagttc aaccatccgg ccgtacgagg gttttaacac cgcaaaacag    156600
     ccgatatcga gaggttgtaa aaggtgagag gagtgcggag gcatatagat tggtatcacc    156660
     ttatttttct cgcagatttc atcggacctc ggggttaaat gacttccgtg gccgtcaagt    156720
     attaaaagcc gatacccccc cttcgtacgc gaagaaggag taggaataaa gagattttta    156780
     agccagcgaa gtccaatttc atcagaggtc catccgttag gactaacctc gaatcgccag    156840
     tcctccggga ggccatcaaa ccaggattca acaaagactt tgcctttaaa aatcacacac    156900
     ggcggaaggg cccaaccagt agcattcgta cactcaataa ccgtcaccca ttcacgattt    156960
     ccgggttgta aaagtgctcg ccgaccgtag tattcgcttc tcgtaataac cttcgtagtt    157020
     gctattaatc ccatcgcgaa accagtctcg tcggagttat aaacgtcatc ggggtcgatc    157080
     ccaaattgaa ggatcgtttt ttgtcccgca gctcctcaga gcagatggaa ccaccaccac    157140
     caccgccgat cataaggagc gagcagaaga attgctggct aaatttttcc cgcccctgcc    157200
     ggacaacatt gaccatgaag ggactagacc acaaagagcg ccagtaggga tgcctgtcgt    157260
     caccatggag gaggtagaac ggcagcggtt ggcggcaaat cttgggaggc acctggcgaa    157320
     gacgatctac cggcgatagt ttggaagatg acttggccca cggtcaagca cagggtcctt    157380
     gatctattcc aggcgtcgct ggaaggaggc acgttgccaa gacagtgaag acatgcgaag    157440
     atcataccgc tcaaaaagcc gaataaagag aactacacca ttgccaaagc atggagacta    157500
     attcactcct cgcgacgctg ggcaagatac tggaattagt ggttgcagaa aggatctcac    157560
     acgccgtgga gacatacggc ctgctcccaa ccagccactt tggagcccga aaacaacgat    157620
     cagcggaaca ggcactcctg ctcctgcagg agcgaatcta cacggcctgg cgtggccgac    157680
     gggtcgtgag cttgattagc ttcgatgtca aaggagccta caatggagtc tgcaaagaaa    157740
     gactgctcga gatgagaaag cacgaggcat accatagaag ctactccggt ggatcgaggc    157800
     gttctgctcg gaacgcacgg caaccatcca gattaacggg caaatgtctg agactcaaag    157860
     cctcccgcag gcggggctac cccagggctc tcccctatcc cagatcttat tcctcttctt    157920
     caacgcagac ctagtacaac gacggatcga cagccaggga ggagcgattg ctttcgtaga    157980
     tgactttacc gcatgggtga caggaccaac tgcgcagagt aaccgggaaa gtattgaggc    158040
     aattatcaat gaagcgctcg actgggagag gaggagtgga gcgactttcg aagcagagaa    158100
     aacagcaatc atacacttca ctcccaaagc acacaaatcg gaacggaagc ctttcaccat    158160
     caagggacaa gccgttgaac ccaaagacca tgtcaagatc cttggagtgg tgatggactc    158220
     taggctcaaa tacaaggaac acatagccag ggcagcgtcc aaaggcatag aagcagcaat    158280
     agagctcagg cgacttagag gcctattccc gtcaacggcg cggcagctat tcacatcgac    158340
     cgttacccca gtggtggact acacatctag tgtctggatg cacgctttca aaggtaaggc    158400
     cgtcgggccc atcaaccgag tccaacgggt tggagctcaa gcgattgtgg gaacattcct    158460
     taccgtcgca ataggtgtgg cagaagcaga agtattgcca ctgcacacag ccggttccgg    158520
     agacgggcag tgaagatgtg gacggacatc cacaccctac cggaaactaa cccactccgt    158580
     aggaacacgg ctcggataaa aaaattcaga agattccacc gctcgccgtt atatcaggtg    158640
     gcagatgcgc tgaagaatat agggatggaa acactggaaa ccatcaaccc ctttacacta    158700
     gcaccatggg aggaacgagt gcagactgat atcgggcaaa cctcaaagac acaggcggaa    158760
     gccggcggat caatgcaaat cgcagacagc agctcggcac ggaatgaagt ggtaggatgt    158820
     ggcggagtta tccagaagca gccgcccaag tatagaaagc caaaactgaa gaccttctcc    158880
     accatgcttg acgcaagatc agagcagaac ccgtactcgg ggagttggca gtaatggcaa    158940
     atgcaattaa ggacgctacc agtactgaaa ctttgtagaa tcacgctact gacgagcaac    159000
     aaggcggccg cactcacact gaggatcccg cgacaacagt caagccaagg acacgttcgg    159060
     aaatatacga gctgctcaga agactacgat gagaaacgga aacagggaca ctatccgttg    159120
     ggtccctaca agcgaggtta acaaactgtt gggcatagtc aatgtgcagg ccaggacagc    159180
     gacccaaaag gaacccatgc cgcacacgca gctccctaga atgagatcaa caattctcaa    159240
     tatcgcacga tccccacgag ccaccagcaa aggcttgcca gagaaagtgg gcaagcgcgt    159300
     taaaagagtg gatgcggccc tcccaggcaa acacactcga caactgtatg atcgattatc    159360
     gtggaaagaa gcgagcgtgc tggctcaact tcggactggc atggcaagat tgaatgggta    159420
     tctctaccga atcaacgttg cgcaaacgga tcagtgtgca tgtggacaag caagggagac    159480
     ggtagagcac tttctctttc gatgccagag atgggcggct catcggacag ggatgctgca    159540
     atgtaccaac acccaccgag gcaacatacc cttcttcgtg ggaggaaaat cgccttcaga    159600
     taatcaagac tagaccccaa acctaaaagc ggtacggacg tcaatatggt ttacgatcgc    159660
     cacgggccga ctcgacgtcg cttaaccatg tagtcgaaca caaatcaccc acccttcccg    159720
     atctaactca caccaaccgc ctcgtgctag acatggtaga cgtgcttcaa ctgccgaaga    159780
     taagttgtta aacacttgaa gaagcgcctt caagccagcc tactaacaaa ataactaacc    159840
     cacgagaatc ccctgcgata ctaacagatg agtcgacata tgctaaaagt gaatttgcat    159900
     gggttgtaag gagacaaggc acaaattagg agagtaccaa aagagaaaag aaaaaaccat    159960
     ctcccacaca acccctagcc accataccaa acccttgcaa caaagctgcg aatgtagggc    160020
     acgcaagatc gtgattgcct ccatctagac aacgaatcca aacccaatca gatccaccca    160080
     agacaatagc gcatccctta gaattccttg acataggcct tgatctcatt atcgcccttg    160140
     gtccagcaaa caacaggctt cgttccgcag tgcttatcac cgcgagcgac cttgagctgg    160200
     tgaatgatgt tcccgacgcg gttcttggtc aggagctgcg agtccttgcc cttcacctcg    160260
     acggtgagga agtacttgtt gggaccctcg aagtacaccc caaagccctg ggggacatcc    160320
     gggatccccc agtaccagtt gccgtcgtag gcgagagact tgtcgtagac gccggagtag    160380
     ttctcgtcgg tgatgtaccc attgatgcac ttgcagttgt gccagggggt tgagccgcgg    160440
     gcttcgagga tgctggagtt gtcgacgagc tcagcgacgg ctgtcagctc gtcgaggctg    160500
     gtcgcgacgt cgatatcggt cacctcagtg gtggtgtcaa ggaggggact ggctgtagcc    160560
     aggggtgcca gcaggaggaa aagagcgaag cgcattttgt gttgcggcaa aggagttgac    160620
     ggaagtgagg tagaggtttt aggacttgaa gaaaagattg tgagatcact ggcttttatc    160680
     cagcggcgaa cctgtccatt atatatgttc gtccaccttc agtcgaagcc attgacctcg    160740
     aacatccaca cagtcggtag tacccgcagc aatagaacgg ccgaggcttt gtcgtagaag    160800
     gttgctgcat gttaagcgtt gagctgaggc ctacaccgtt agctatgaga cagggggtgg    160860
     tgtccgggtt cctggctata cactacgttg tcgcgacact gagttcccag acccacccgg    160920
     cgcatcttag ggaattcgcc gtaagcccct gacgtgccaa gcccatgcta gcggctagac    160980
     cccgctacct catgccacta tttaaccgtt cgatataagc tgtatgtatc aagcccacgt    161040
     cgttaccgag tattggtatc cagggccccg gttctgcggc tgagccgcca acaacgatta    161100
     gttctgccct gtttgtagtg tcgcctacaa cgtccgaggg cgagagtctc gagtgtcagc    161160
     cgcaatggcg cgttgtgcat gggatggtgt tcggtggggg ccgacttcat ttcagctgga    161220
     ggcgcttgtg gaacgccgcg ggaacgcaca acgttggacg aagttggaag tagatagcac    161280
     gttccccatc taggacgaat acccggggct aggcctctct aggaaggcta gcatgcggcc    161340
     ggggcccgcg agcggcagat ccccgccggc tggatcccac gagacgagcg ggccagtcat    161400
     atcctgccgg ttctttatgc ttgacgcgcc ctcctatccg aactcactgt gtggatagac    161460
     gaccattgat tttagaatta tccagcctcg cacgtgcggt tgaccgttaa ccagctaagc    161520
     ttgtcggcgg tgctgggatt gtttacccag ctggctggag tatagataca aagttggatg    161580
     tagattataa aaaggtatcc aggacccgat attctttctc taggaacctt tcctccttca    161640
     ctttcaacat ttccttttca attcccaccc actacgtctc ccagttctaa ttaccatcct    161700
     caccatgtcc gacgaattcc cgcccctagc ccctctcccc caactaaccc tccacccatc    161760
     aaccgacccc tcgcaaatcg acgcccccaa aatggtcaac gcctggctca ccaccctaac    161820
     aacagcccta accgccaacc aacccatcat cttaacaacc cacttcctcc ccgaccactc    161880
     ctggtggcgc gacctcgcga ccttcacctg ggacatcgca tgccacaatg gctccgaggc    161940
     aataagcaag tacctccgca gctcgacaag cgggtttaca gaagccgtag cggatctgcc    162000
     gggcgcgttg gcgcctcact tggaggatat gggcgggatg aaatttattc agtccggatt    162060
     tcggttcaag acgagggttg ggaagggacg cggggttgtt aggttggcaa atgttgggcc    162120
     cgaggagtgg agggcttgga cggtgtatac ggtgctggag aggttggatg ggcaagatga    162180
     ggtggaggcg cggcgggaaa aggagcagtc gactctgagt tcttcgagtg gggcggtgct    162240
     ggcgagtacc cggggcgaag gggatgtgca ggtactggtg attggagtag gtgagctacc    162300
     cacaggcaac atctcctggc tgagcgttac gactaactgt actacgacaa ggccactccg    162360
     gcctcgccct cgccgcacac ctgcaacacc tcgggctaaa ctaccttgtc gtagacaaga    162420
     cttcccgagt tggcgactcg tggcgaaacc gttacgaaac aatcaaattg cacacgccca    162480
     gctacacaga ccactacgcc ttcttgaaat tcccaaccaa ctggccgcgc taccccaatc    162540
     aggaccagat cgcgaactgg atggagcact acgcggctat catggagctc aagatccagc    162600
     atgacacgga agcgaagaag atcgcgtacg atgagtcaac aaagaaatac ctctttgagc    162660
     tgaagggtaa ggatggcatc acgtggacca tcactgcgaa gcatgctgtg ttagcctcgg    162720
     ggttgttcaa cgataatatt cccgttcgcc ctacgttcgc aggcgaggac tcattcaagg    162780
     gcgagatcta tcacacgacg gcgcataaat cggctcggtt cgttcccgag ctgcagggca    162840
     agaaggtaac gatcatcggc gccggaacga gcgcgcacga catcgcgcag gatttcgtca    162900
     agcacggcgc gaagagcgtg acgcttgtgc agcgcggcga gatctacgtt gcgtcgcttg    162960
     gtgccctcga ggaggtgtcg ctgaaagtgt ggaatacacc aggggtcagc accgaggatg    163020
     cggacctttt gggtagctcg tttccgtggc ccgttgttcg tacgctcagt gtgggcgcgt    163080
     cgcagatgat ggcggccatt gacaaggata tgctggatgg gctcgagaag gctggagtgg    163140
     cgttgaagag aggcgataag ggtgacagtc ttgtcgatca ccagttcatc aaggggggac    163200
     attcatacct agaccagggc gcgtgccaga tgattattga cgggcgaatc aaagtccgga    163260
     gatgtgagaa gggggttcag gggtactacc ccgagggaat catcctagcc gatgggacca    163320
     aggtcgagag cgatcttgtt atcctcgcga cgggaattga gcgcggtgaa aaggttgtcg    163380
     agcagattat gggtaaggat gttgtggata aggtaggggg gctgtttggc ttggatgagg    163440
     cccaggagcg gattggggta agtgtgccct caatccaggc atctgaggat tgcactgcag    163500
     ttgctgatat ggtttctata gacttggcgc ccgactggtg ttgcagggtt ctggttcacg    163560
     gcgggtagtt ttgcattctc gaggcagtat gctcccaccc tcgcgttgca aattgctgcc    163620
     gctgagtggg ggttgagcga taagagggag taaaaagcag gcgcttagca gtatggcata    163680
     gacttagaga ccgtatgtta ggaagatagc tcatactacc ggacagccca cttagacagc    163740
     atcatccttc gtgcctatgt cgggccaccc agttgcacta ccagaagaat cactaatttc    163800
     accatttacc agagtccatt cctagactag aagtgggtac cataatttat ctatggccag    163860
     gacgcgtgag aagggtgagc aaggcaaatt gatctttcct gattacctct gcaaagtagt    163920
     tcctattagg gcaatcttgg ggagatacgc ataattgttc cttagccctg cttcacagat    163980
     cgccgcgtat aaagcaatcc gttccgccac ccatgcccat gtggaagtag agtggatacc    164040
     aatcggccac atctacaatt gactgcagga taacttcttc actgcttagg ccattttcaa    164100
     taggttttcc aatccgggcg caatccgggt tcgcctctcg tctggcggaa attcatccat    164160
     aatgtccagc gcggcattgt ctgggctagg cataacattt tcgttggtag ccgcgtccat    164220
     ttctgctaca agctcatttg aatcacgctc tcccattgtg taattcatcg aagtctcttc    164280
     tgcacgctcc ctattcactc ctagtcctgc attgctatca agctgtgcgt ctcctgctcc    164340
     agccgtgtcg cgtccgatag tgtctttcct tgggtactgg aattccagca tcttctcaac    164400
     caaaactgga gttctgtcgt ccatttgaaa tggctctttg gtcttctgat cacgattata    164460
     gcttgtcagt atcgttctgc agggttgttt acgtgtctga tctaatacag ggtgtaacag    164520
     cacactaggt ggttcactta ccgcaggccc atatctggct aggtggcttc cgatacagta    164580
     cttaatggct tggtcctgtc tttcagcatt ctccgtgtcc gaggcctgac agaaagaagt    164640
     tagcccgcga aagtctctct ggttctgcgt ccgcgaacct gcgcagcgtc tttagtaata    164700
     gcatcctcaa ttgcttgccc tgagccaagc tctttgctgt tgaaagtagg gagcggagct    164760
     gcccgctatc gcctgtatca aacgctacta taatcttgtc tagtagttgc tgtgctgtgt    164820
     taagcttttg ctctgcaagc ctctgtgcat attttctgcg tctgtccagc gtgaccgtaa    164880
     acacgcagct gctcccagtt ccaacgcatt catcacaggt ccgggacccg gcgtactgcc    164940
     aacgttgcat gtgaagaaca gaagtgcata gtcaagagct tggccactta ctttggactt    165000
     ccgcgcgcta catgctgtac aggcatttga ccgtttcgcc cgtcgtggga caggctgcga    165060
     cgctgtgggg gggtgatcgg atggaaatgg agcaagagcc cgtaacagcc catgaccaga    165120
     ctgtgacgtc atgctgcgaa gcgttatcga agctcctcaa catgaaaggg gttcaagtgt    165180
     cggatcgagc ggtcctgacg acttgttgtt tcctttaaga agccggatac tttcagtgtc    165240
     ttgatccata tatggcagct gatagctgat aagagttgta aaatgccatc aaaatggtta    165300
     cctctcgttg aatgcaatgt gctgaaaggg gccgccgggg tacgcgggac tgaggcagct    165360
     ttgacaaggc gacgaattag gtcatcatct aggggaggat cgaatgaccg cccaagcacg    165420
     acaacttgca aaagtacata gataaagagg ttgaggacat gctgattcat ctcgatcttg    165480
     gacctatctg attggcttga ggtcatggag gtagcatcaa gagcttggcg tcgcaatttt    165540
     tcgaaggaag atttcagtag actggaattg ttccgttaag atagaaatga ttgatgttaa    165600
     aatttgtcgg agtaatgagc tgcatgcgca aggggctcct cgggcggcat ctgaaacatt    165660
     tatcaaagtc catggccgaa tcgttctgat aattgcgtca ttgacctccc acgaactaag    165720
     acagtcgctc ttcgacctaa tttagccaac tattaggctt tagggcacga cacgatcata    165780
     catgatggct tcgaaatttt tcatttcagt ttgatagcgg aataataggg caagctcaat    165840
     cgtccctacg catcccgtgc agatcccttt atactatatg acgtcagcaa cgtcgttcgg    165900
     ggattatctt tctgcctccc aagcggatgt caaccaaggc gattcggaat cccctcccat    165960
     ccaacaacaa gtacaaccct cacttttgcg gcccgttccc tggagaaata tctctcttgc    166020
     ccctccccac ctcgggaaaa tgacaagtat agtcgtactt catcatccag cgtaatggag    166080
     aaaaggagat ttagtggttc aatttcacag tccaattgcc ttcgtttgaa ggcgtcaagg    166140
     caatcagcca ttgttcagca tgaagcacag gttgcacctt cacggagacc cggtaagtag    166200
     aaggagaaaa atggtcgtta ccggttaccg tatgtctcgc atacatgctg atgggtttcg    166260
     actcgtctca aaagttgcat gcttttatat ccgattccct gacaattact ttcaccacgt    166320
     gatctatata ccagaacgga cgatctgtga gttaagggat cagattatgc gcaaggtcca    166380
     agttcgaact cgcaccatct ttcaccgaaa cggtgcaggt ccgaatatcc tggtagataa    166440
     cgagtttgtt cgtcaatttc ctgatcgcca ggttatgatt gcggagttcc ttgacactgt    166500
     gaacatcgat cgggatattg atgttactct taaatatcaa ggtatacggc acctttcttg    166560
     attcttgttt gttgcgggca ttgaaattgc taagctaggt ataggatagc cttgcatgtt    166620
     aagggttgcg attaacaatt gattccacag taggggatag agtagggttg ctgttcgttg    166680
     ctcattgtag ctttcactcg aacattgaca catctacata gctggccagc tgcacagtac    166740
     aattaagcat gcaagctttg cccaagcaag atagcactct tccttgtgct ttcgcttggc    166800
     gcttgttatg atatctatca cgtgaatgac tgtgcggggt taattaagac gccgctccgt    166860
     agttagagaa tcaagcagtt gcttcccagc aatgggtgat gatctgggat tggagcttcc    166920
     gaatttacga tgaatgactc atctggcttg ctgtttctta attgaggttt gtagactcct    166980
     tacttcatga tcgtggttaa tctcatgtca gagacagaaa agtatcattg gacttaggaa    167040
     atcgacacaa attaatgcga cggttggacc aaccgggttg gtccaggagt ccgtcttcat    167100
     ttgcttacta ccagtcgcgt cggttttcga gatcgcgacc atgagaaggc ggaaagctca    167160
     tgcatggtac tagaagggca acccctgacc gcctaccggt gtcgcggcaa tcttctggga    167220
     ttcggattcg gattcggatt aattcatacg ccgtcccagc caatgatatc tatggctatg    167280
     cgcgaactgc cccctctgcc gtaagcagat tgggcaatta tcgagaacta tttgttgtga    167340
     tatgaggcta gtgcagatca ggaagcaagc cgcaccatcg gaattagctc cgaaatgtag    167400
     ggcaataccg ccaatcgtcc cagctcgtag tttatggaca tggacagtaa ttgctttcat    167460
     catggcgagc acgcttggct cttcctcccc ggactgagtg tctgactcct ctggagttac    167520
     cggtcgacga cgataagaac cccgggacga atgctgtttg tagcaccacg atgttgcttc    167580
     tgtgtttctg ttcttttctc ggcctgtaga agaaagtaat ggagcatttt agaaggtgtt    167640
     acaatctcat ggcggcctat atctggatag tcctctgtaa gattcctcgt cgcgaaatct    167700
     ttcaagttca accgtaaagg atctgtatct aacggtcgtc catcgcgggc tcgaaagacc    167760
     tagcctggta acttagaata ctctcgtaat gccgagaaac atactttttg gccaacaaca    167820
     acagccgcta caaagacctc ctttccggcc tcaaggcggt aatcaggccg ccaagtagat    167880
     atagttgcct gtttagactt ttgatgttcg atatccaggc acacgacaac attgatgcta    167940
     ccatcggtac acaaaatata gtcgtcggct aagtaagtcc cttacggcct ggcgtttccg    168000
     agagtaggca atttcaatga caacgcctgg atattgtgct tcagtgtgtc caaaggatgc    168060
     atctggttct cgtaagatag aagttttcag cccattctga agcatataat gacctcgctg    168120
     tgagcatttg cgagtaattc gtgcctcaag tattcataac tatttgacag actccaagtg    168180
     acagcatatt tggttattat acatgttctc gaccatcaca gctaagctac ccatcgaatc    168240
     aagtgccaag gcctgcacac cgagacagcc gcctcctctt caaccagcgg tagcagaacc    168300
     aagcagccac ataccgggat ggctgggtgt ctctcgtaga ggaggcaacg caattctcct    168360
     ttaggagaaa ggatgctctc ttgttgacat cattcaccat cgccgccccc atgacggcaa    168420
     cccacatatt agcttcagga ccatgtttca cccaggtcgc tcgctcagtc ttcctgatcg    168480
     cttcggtgag ttgttcgagg agttgctcga gcgccccctc ggaccatggt aaatggtcgt    168540
     ccagtagata tgccaggacc ctgccggaga tgacacaggt tcgtaggagg gcaagttcct    168600
     tcttcggtag tccgggtggc tgatggctgt tgagcaagct tgggtcccct tcagaccata    168660
     atttatccag caggtctcgc aagcgtgggt tgttcatggt ggtcctcgtc cgtgcctcag    168720
     tattggcgta ttcctcgtga agtagctggt tgatattctg gaacaaaata agcaagcgat    168780
     acctgaggtg ttggcttgga gacttgtttg atccaatcag gatcaaggag attaaagtgt    168840
     aggaaggggc tgtccttggc attccaggaa ttgggaatgg ctcggcttga tcgaagaaga    168900
     ttgcaaggaa agtcagactt ctgttgcatg gaagagtctt ctattagctt aaataaccga    168960
     tcatggacgg acaacgtacc cctgaataat ttgagccagg aagccatcgt acccaagttt    169020
     atccagtcca ccgcgggcag cgataagttg cataagcccc cggcagtgca cttgtgctaa    169080
     attttgatca aattgaagag actacagttg tgcgacaaaa gaagaatcag aatcgatgct    169140
     agtggtcaag cttcgagaga tcacttacac tgtgcattgc tagtagaagg acagacgcaa    169200
     ctgtagcatc attcgggctg ctcagatcgg ctagtctaga cctcacaaga ttgatcgtct    169260
     taaactgatg atataacgtt gcataggcag gctgctgggc gcctgttaac gcgtcgaact    169320
     gcacggaggc tgaaaatagt gtggcatgga gaaggcaggg atcactaagt gcatagctga    169380
     tccacgtaga ccgtaggtag taggctagac tgtctgcttc cacctgaaag ggggatagac    169440
     ccaatttatc ctggactgat gaacgattag agtgcacttg taatagtcga gagagtcgac    169500
     atacagaatc ggatcagcat aggaacgtgg acacgcgact cgattgggta gttcaacgtg    169560
     tagttgactg aatctgtggt ggggttggaa aataacggat catgtatgcg ttggacgtcg    169620
     cgttcaatca agccgttatg catgcaggca atcccgagcc tggttgctcg ttagcgtggt    169680
     aaaaccggac ggggtgacat ggtgctttat cagtaccgtg tgcaccttgc gcagattggc    169740
     tgagtagtgt cacagtgttt tttcaggcgc ctgcagtggt aacatgcctt tgatggctcc    169800
     ggcggggatt cagacggtga ggtacgcgcg tcaaggtatt tgtgctccat tctaatcccc    169860
     agtaagatga gggcaaccgg aaagtggatc atatgtttgc agataaatct gggaatacct    169920
     catattgcgt acgtcctcac ctgtcataat cactctactc gcatagaaac cgaggagatt    169980
     gttcggaaac aggcatcgac ggttggatct aggcgcacat caagatcttg ggtaagcatg    170040
     ccgaaggcga gaaaggcgac aaggcgggaa ggatggctct ccacacacct ctggcatctt    170100
     gagcatactg gcaagttcct gtcgcatttc ctctttttct ctttgcagga gagacatgag    170160
     tgacttgatt tttgagcatg tgtgggccac atcttgattg atttcagcag agatgtggct    170220
     gcagtaggca agccagcatg tggtcatata aggaacgcgt ctcgagaata taagacttgt    170280
     aatatatgga tacgacgggg aaagagaaaa acggaaggag cccccacaac gggacccatg    170340
     accgaggaag tcacatggct cgtacagccc cagccctgcc aagtttataa gtgtgaggct    170400
     tagccgatcg cctcgatgga tctctttttt tgatttcttt caaaattaaa caattcatgt    170460
     ctctccagaa aggccccagg ctctctgaat ctgggttata tcgtcgttgt tgaacatctt    170520
     tcaacaatcg agcacatgtc cccttcagtg gtaagtttga ccagagcagg tgccagtgga    170580
     gcgcctgaca gtggtctagt gtgggaagga atggggtcac cacctcataa gagtacctat    170640
     aaagctacaa agttgtgaca agctagcggt ccatcgactc caccaccgcc actaaggccc    170700
     ctagtgcagc cgtacggtag tgagttcctt ttgtccttgg gagtctcgaa ggtgtttatc    170760
     ggctgtgtgc taagattacg ttatccggaa ggttcaaact tcaccatttc ttacccgcct    170820
     gcttcaaatc ctactaataa atactttaga gtaagatatc aggaaagctg caagacggca    170880
     aaatatggtg tcactgcctt ctatggctta ctgcgtatcc ctaaccagta gtattagtgg    170940
     taccatatcg gcgttctaaa caacagctgg taacgggaga ttgtccgtaa cagagcaaac    171000
     cccccccccc ccccannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    171060
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnccccc    171120
     cccccccccc aagtatactg cgtacaccta ctgtatgcgt tcgctatcca caatgtcgcc    171180
     cgactgtcag aaatcagccc tattttttct cgccaaccaa ctccagcgac agattaaaca    171240
     gtctccgctt cccttcaggc ctgtacgcat gcagagcgta cccaggcgcc cagtttcctt    171300
     cagcaggatt ccatgccttc gaaatctgca cgttctcgag gtatatcccg cccatcccct    171360
     ccagagactt cgaaacagcg gcccatgtcg aagtagcagc accctgctca gcgctcttga    171420
     tctgaggaac taatatagga ttgtcaagga ttctactttg ctcctcctct gatataaact    171480
     gtagaagtcc actctggata ccacaggctg ggcactaaaa gcacggagac cctgcgagga    171540
     gtaccggcgg tcgatctctt ctgctgccaa gagaagagca cacttgctct gtccataccc    171600
     tttccacttt tcgtaatcac cgacaagatt gatgttgtcg aagaccacct ccgagcaccg    171660
     acgcgcaacg gagaggatta tcgcgcggga atttgattcg agcgttgcgg cggcgaggag    171720
     ggcagggcgg aggggaataa acaccagaaa atgggcgaga tacttaactt aaaactgagt    171780
     ttcggagttg tctttggtcc gtccctcagg ggtagccatg acacccgcat tggcaatgca    171840
     gatgttgagg gtttgcgtct tataaagcag ctggctagcg caagtaccga cactgggaag    171900
     agactccaaa tcagctccag aaggcgcaca cgagggagtc tgccatctca cccaggacag    171960
     cttttgcctt tcctcgattc cacgctgtga ggtagagggt tgcgccggtg gcaaagagcg    172020
     cttttgctgt ttcggcgata ataccagagg aggcgccagt aatcaggacg gatttcccct    172080
     cagttggtcc tctaagccct catcaaggac gagttgaagg gctatcggcc gggaatctcc    172140
     agggccctga gggtttctgc gaacgtcggc ataacctgtt gtcatgatgg gatggatgag    172200
     gattgtagag tcaaggttga tagcaggaga tgaaaatatc caaattgatg atgtgactac    172260
     aataagatac acactcggca gcaatttttt tactatagaa aatggcgatt tcgtgaaggt    172320
     tgctgaccgt ccagctgtca gcgaggcagc gacggacggc gatcccattt ttgcccttaa    172380
     ctccggaccc gaagtcgcag aatctgcccc tgatgcgcct gccgccgaag cgaagtagta    172440
     tctggcccca ttcgcactgg ccgaatcagc cgccaagata caacatgcaa cgttagcagc    172500
     tagtggatcg tggaagcatt agtttaagcg gctgaaaatc cgttcgggtc cagggctgac    172560
     ctggtcagtg gagcttgcca agcccatggg ccttgaccct gcaatctgga tcacagacaa    172620
     ccgtcagcgg cctttggtct ggtttaccgt cagtgatgct ggggtcaccg ggacatagtt    172680
     gcttctcttt tcgccgcgta ggaaccacag ctccaccgac atcaccgtat caatcgaggg    172740
     gttgcccctt ccagcccccc gtttatgcca agtacacggt cctactcttc cggcagttac    172800
     aaaacgactc cccgatcttc aaactcgcta ttagcgatgc gccttctcct ttcactcttc    172860
     aagcgcccgc tacttcggcc cacggcgcta tgttagtggc ggtgtggggc cgcaacgcta    172920
     tgagcgtaca atatacaacg tactttgtgc tgtatacgcg ccgacgtttg tctagggttt    172980
     ccgctgacag ctgagggcaa ggctgaatac aagctagcct gggtgttctg cctgcggcca    173040
     gttactggtt acgtaattgg ccaggatctc aacttgggag cgacgagctg acgctgtgca    173100
     attctgacat ggaatattta tagcagctgc attctcattt tttcccgcgg tacaacaact    173160
     cttctcacag aacttgaaac ctcttccatt ccccacaatg tctccctcca ccgacttcgt    173220
     gcgctgcgcg gctctaatgt tgcacggaga tgtttttatg gatgttggca ttattctaac    173280
     tctctctctg accggatctg ttggtccaag ccccaggatc caacatctcc atttcagatc    173340
     tgtgtgccat taatgtatgc agcgacaatc gccaaccact ttgtcgcaag ccgcaaagtc    173400
     gaccccttca tcattcgctg gcaccagttg ttcctgcacg cgtgggagaa tcgcccgacc    173460
     aaccctagtt ccaccaccac gagcaccaat accaactatg gggggattgc cagaacccat    173520
     tgcttgagtt cgcgatgaac cggagctact cggccatagc cgagaaggga tataattgag    173580
     acttcccgtt taacaaccac catgcccaga tcaaatcaat aaccagaatc tcagtaaagg    173640
     aaaacgcaag actccctcat gcaataaaat ccctaatgcg acacaccttt cctcggaggc    173700
     ggtgtagcgg tagtatctgt gggccggcag ggccggcagt atccccacgt caccactttt    173760
     aaaagattac atccagcgtc aatacagtca catttggaga tgcacctcca taataggggg    173820
     atgttgacct cattcttgca tcgtatatca agaagccagc gagcaattag acaacccctt    173880
     tcaagcctct tgcaaaaaca cacctttggc taccaagacc gctctcataa cgcctcttag    173940
     gcattctcga gcattgtcgc tggtctggtg ctggacaagg ggatgtggcg cggcagcaac    174000
     cgattcgaaa cgagggctcc atgaagagac aaagacctgt cctataggac tgtgtagtta    174060
     agaagttcta gccactcaac caagtcaatc ttcgccgctt gatacattga ttgatctatc    174120
     cccattctat tgtctagatg ctactgcctt catcaaacta aggttccaga acccccttcc    174180
     tcatagtctc cttcggcctc tcaacatcaa caaccctgat cccctccctc gtctgccgaa    174240
     aatgcacagt cccataccgc aacaactccg caaacgtccc ctcctcatca tgcttcccct    174300
     cattcccctc caaatcccac agcagcccca gcgcaggcgt cttcgtcaaa tgcttcccat    174360
     gcgtaatctt ctgcatactg cactgcgcca aaaagtgcca cgccatctta tacgccttct    174420
     tatactcctc actctcggag tccgcatcga gtcttgtcgc aagaacatca aacgcctcct    174480
     gccccgtaaa cccggcgata gtctcaaacc cccagttctc ctcgagcaca tcaaaccaca    174540
     taatattctc ccccgcgtag tccacacagc tgaacccgtc ccctgcctcc tcgaggagac    174600
     agaggcgctg ccacgcaacg acctgcgtga tatactcaaa caccgtcagc ggatcgacta    174660
     taaactccca cttgaacccg cgcgcgacac tggcggagaa atcctgcttc agcgcgaagg    174720
     agagaagcgg gttctccgtc atccccttgt aggagttctt atccttccat acgtgcacga    174780
     agagctcgtg ccagcgctgg atgaacgggt cgcccttgcg actcgcgacg aagtggttcg    174840
     ccatcacggt gccgtacatc caggggacgg cgacgttata aggggtggtc gggtctgcga    174900
     ttgcgggcca gcaaatgcgg tcgagggagc gcgttaggat gatgccggcg tccatgaaga    174960
     cgccgccgta catgtagagg gatgcgccgc ggaggaagtc ggcactgtgc gggccgacgt    175020
     acgggccgtc cattgtgccc ttgacgaatg tttcagggag gagttcgggt cggatgtatt    175080
     ttagggcgtg gtttggtgag ttggggactg tgtcgaggac gcggatcgtc caggaggggc    175140
     cgcagatgcg gtgccagtcg ataatatttc gctggcacca ttgcggcatt gcggcagcgc    175200
     cggcgtgcca gaaggcccag atgttctttt cggatgttac tggtttatgt ttggacaagg    175260
     agacgaggat ggcttcatcg cttcgtgagt caaggggttc ggcgacctcg agctgatcgc    175320
     ggaactcagc ggggatgctg aactttgatt gaggcatagt cgtggtactc ggtcttgcaa    175380
     ttgtcaagag tgttgttctc catgaaaaag cgcgggatct gtccggttga aatatgtttt    175440
     cgttctcagc tggtacgccc tatcttcacc gatctcgctg ccccttcggt ccacccgaca    175500
     gcctggtggt ctcttgcgaa aagaaatgtc aaatctctta gggtaagaca gtttggcgcg    175560
     aggctcaacc tcggaacacg ctctagcggc tggtcaccac cagggctagc ggctattcgt    175620
     cccaaatagg aaaggatccc caatctagca ttctcccatt tgcgggctcg ggagcaggct    175680
     aactgcataa ggcatttacg gaggttgaaa agtcggggac gccggaggga gctgaacttt    175740
     tggcccctcg gcagtttcag agctcaaatc tgtcatgctg ggctctggca atttcggtta    175800
     agtgcaccgt acgggtaata tcactcgtca atcatcacag cgtggtggat ccagacaagg    175860
     acatcgattc gcgcgactga ctatattgag ggacaggtgt caagaatacc ataacggtgc    175920
     accgacaaat gtcgcaatac tcaggagagc cacactcgcc ctacacattc ttacctatac    175980
     ttcagccgcg cattttttaa ctaatactta tatgattctc tactagacta ttgagtatat    176040
     acttattaga aaaaagttat ataggtttag cttctagcac cttagtattg tgaagggctg    176100
     tagccaaatt gattcaacac tgactaggcc aacatgctgt ctacaaaaag cttagaggag    176160
     gaaaggagtg gaacaagcaa aacaacaaaa gaagcagcgc gcaaggcggt gggggcgcaa    176220
     ggcggtggca gaacaggaac gtgcgggaga gaagctatag ttatggcagg gccatatagt    176280
     aagaagcggg tctaaccagt gacaagtata acctaagcca gcgggcatgt ctggagtaaa    176340
     attagtatgc ccagagcaga ttcctttcag taatcactcc caacgccgct ctgacagcac    176400
     tgtgatggta gagtctataa tattagagca accaatagcg cctgtaacag cccacttggg    176460
     ccacgccagc gctctaacta gtccttgaag ttatagcgtt ttagttacta gtaggtccta    176520
     cgtccctagg gaaacataac catggcaagt tgttttattt aggtgctctg atatattacc    176580
     tatttcacta aaaagaaaaa taatctatta ctttcttttt tattatacta atgcgcagtt    176640
     caacacatta gctgctgact tgaattggaa ccgtaaatta gggccgccgt aggtgagcta    176700
     cgtctcagct ttttttaccg aaggcaagtc aatggagaaa tttacttttt tcgctaaaga    176760
     atacgtatta ctctaccatc tcgtccagat attgattcca ttatggcgac agatcttcaa    176820
     cgttgtacct tcggagtatg attgggactc atttttttgc ctaagatagc gttatggtcg    176880
     aagaacgatt tttcaggcaa ctggtttcct tgctgaacgg tttcgttctc gtcaaaagag    176940
     gaaagataag ctagcaagat tcagcgttca ttcgaggcta acgaggtctt ttgcggctgc    177000
     aggatgctgg gcggggcgcc cgctagcgcc attacttcac attgagcatg taagcccctg    177060
     cggattggaa taatttgatc tataaacgtg gaaacctttc ggtgaacatg cgttagaaat    177120
     tttgaaaaag cgctattcca caccctcata taaccatcat gaccgacgcc catatcccca    177180
     acgcaaaagc aacacccgga tggcgagaac tgccgtaccc aagaacaagt tttgacgatg    177240
     ccaacaagct cgtcccagtc gatggcgtat cagggctata caaggcgttt gggccacggg    177300
     attggagttt accccgtacg cgcccacctc ccacccccca gctcagtgct attttctatc    177360
     gtcgttgagt tatgcagtct gacgcagaaa gcagatgata atggcccctc tcttcacgga    177420
     ggttatctct gttccgtcct catttccggg agcagagaat atgcacgctc aacaagtcta    177480
     gtcgatctaa accaaccaga cccgctgagc atgcatgttc aattcctcga tcttgcccca    177540
     cagggacccc tgcacgttcg cttcaccacg ttaaagtcca gctcgcggtc ttctgttgtt    177600
     cagggtgaga tttgctctgc acagtctacc gctccgagaa agacatacac cctcgcgatc    177660
     tgcacaatgg gtaatcttaa cgacaaggcc gggatcagcc ttgagttacc cgggcatgta    177720
     cttccgagtc gtgaaacaga ctgcgcacgc ttgacagatg cattcgcgtt tttcaccagc    177780
     ccgccaacct ctgcctgtcg cgtgtacaca cccaggggcg ggccaacccc actctggagt    177840
     cccactatcg gccagcagaa gcgcgatcag tgggccaagt tggataacgg cgagaatttc    177900
     cgactggaag aactgggttt gttggctgat attgtgcgca tcacacaccc tcgagtcttg    177960
     cgttctgctt ttccatgatc gatgtatatt tctgaatagg cgctgaccgc accaagcagg    178020
     tcgccgccat cccgctaaac tatcagcccg agggcatgaa atcgctaatc aagttcaacg    178080
     tccctagcgt gtccctgacg tttgacttcg tgcaggaccc ggcgggccag aaagagtgga    178140
     ttttgaaccg ggggacgatg aacaggttgc agaatggacg attcgatatg gatctgctga    178200
     tgatcgatga agaggggaag ttgatcgcgg cgatcaagca tcaaagcctg atgttcgaga    178260
     ggaagaggca tcttgggaga cagcgtggga agaagaagga tggggaagcg cggctgtagg    178320
     acgatattcc tagctcgtct gatattgact atggtgagcc agccggctgt gtatggtaag    178380
     ctcagctact ttgcaaagga gctgtgagta gcgcataaac aaagttagca ttgtatctac    178440
     tgtaataaga tgtgtataac actcagccgc tagataataa atcattgagc tatctcgaga    178500
     agtttcctca gattactggt ctcagcgaaa catcgcatct gaggttatat attttgggat    178560
     ttctacagtg tctagcagta gctttgaatc aagagacctg tcatgcaacg tcttgccgca    178620
     ggtctttgtt gacagttgaa gggcaggcgc tgactgtaga ggaggtggag aatccaggct    178680
     ggtttggctt cacgagaggt cgaagcacat ttgttggagg tcattgttgc gtggactccg    178740
     gaagggatcc acataaaagg gtcaggccta agaaggactt cgactgcgac ggatatgtaa    178800
     tattgtcggc tacgtgccga cccattgcag gactcaaggg aagattcaga cacgagaaaa    178860
     atgcctaatt atagatcacg tggaagagtt tcttgagtcg ttctagagtt ggaatgtagc    178920
     tcgtgagtca tgcatgctct ccggatcact cttccggacg caaccctcca tgacatcatt    178980
     ggatcatctt caggcccgct caaggaaacc tgatttccga atcgggtgcg catggaacga    179040
     aagtgaagcg tcatactgaa taggccaaga aggtgctgta gctgtggata ttcttcgcaa    179100
     gtcctataga tagtcacgat aaattgtatc ccaataaatt aattgctaag ccaaatcgga    179160
     ctaccaatta atctcaaatc ccgaaccata tggcatatta gcgcaaaaat gaccattata    179220
     aacgaagaag gtgaggctgc ttcttcctgt atagttcgaa catttgtatg ctcattatgg    179280
     agcgatctcg gatcctatcc gaaaagaaat aaccgacata aaaaacctct ttgcagtcga    179340
     tactccctct ctgaagcctt aaagaccgcc gttccctatc accaaggcct gacgccccca    179400
     gatagcccga cgaaggggac aactacgtct caagctatcg tgaaggatct gaagcatctc    179460
     tttggtgtgt tcttgagaag acgctgctcg atcttaccaa ccaagaacct ccaaacactc    179520
     ctgtctccca ggaccagttc ccacctggcc ctgacatggt tcgactgaag caactgctgg    179580
     tgaagctcac ccgcgatgaa cgtgcttcgg gtgaactgtc tgtggcaact aagcctgctc    179640
     agtcttgtca gccttgtcta gcaagcaatg aacaggagga aggagttcag gtcgcagatg    179700
     aaattgatct caacagtccc atctgtactt cccccgatga tttcaagttg tttgagaagc    179760
     gggcctcgac accccaattc aagacggtcg tggaaacgta tgagccacaa gccaaccccc    179820
     ttttctaatt cctttagaaa atggctgaca cagagatagc tgggacaaag aagcatgtaa    179880
     atacaagatc gccgaaccgg tggagaccag cagcggtctg gatgactata ctggatatgt    179940
     attcgttgtc cgtgaacgtg ttggtacgta acacctttgc atgccggacc gaaaacctac    180000
     taatagtatg atcagaccgg acgtccgagg atgtagtgcc attcatagac atcaagtcgg    180060
     aaggcctacg cgacatcctg cgagacgtgc tgcacgacat caaggccgtt agcctgatgg    180120
     aggacaagcc atcggtaatt gagacagtat tatcatcaag gagcacgctg acgtggattt    180180
     agatcgagca aaatttcctt ttccatttcc tcccagagct ggacagatgt gcggagagca    180240
     tggatagcag ttcggaccat gggtgggtac atacggagca tctcttgctc atcgaccacc    180300
     tcaagcacgc atatgcttct actttgcagc gtctcgaatc aatgttgcag catggtcata    180360
     ttacatatga ccttctttgg gcgcttttca agcctggttg ccatgtttat accacatgca    180420
     ttggcacaaa agagccgcga tgtgtcgtat tcgacgcggg cgaagagatg actcaaaatg    180480
     acgagacgtg gttgaatctc gagtgccgat tccttgatta taacggagtc aagttcggtg    180540
     aggccggtat ctttctgcgt gtggccaagt cccgagggtc aaagccgatc gagagccttg    180600
     aggccttccc tctccgccac catccaagtc acgagcaagt ccggaaagac ttgctcgaaa    180660
     gaggccaaag gtttcgggat ttggccggct cgcatattca gcactgtaaa ggcaacgcat    180720
     tctttatgga caaggggaag gctttcaaag tcaacatcaa cagtcgtgtg gcggtagacg    180780
     ccacattttt ccatgaaatg cagccaaact actcccgacc gtcgctccgc gacattggga    180840
     tcaaggataa ggatggaatt tcagtcattg acattggtgc aatgctcatg gaggaccgtg    180900
     agcgagagaa ggagagaatg cgaggagagg gtgtggatgc acaaaagctg agcgaggccg    180960
     atttattggt cgcctgccca acagttttgc tgtttcagtt tcaaggagaa aatgttctgt    181020
     atgtgagacg accgacaata ttttggcgtc cgactaatgt gattccagtg gagtgtgcag    181080
     tcagtgctct tggggacgtg gattggtcac ccgaatcgtt cgactgcctg cagatccctt    181140
     cagaaaacaa ggcaatgctc ttgtcgatgg cgaaaacccg cctgggcctg ataccgaagg    181200
     taccgtttga tgacgtgatt gacggtaaag gccaagggct caatgtgttg ctgaagtatg    181260
     tcggagaatt gtatctgctc tgcatagcct tcagctgact cgttctagtg gtccgccagg    181320
     cgtcgggaag actttcaccg tcgaggcaac ctcggagtat ttcaaactcc ctctctactc    181380
     ggtattaaca attcattgcg tgcatattgg cctatctgac tttctcagat atctgcgggt    181440
     gagcttgttg tcgatcatgg cgactcccac gcacttgaat cacagcttga aatcatttcc    181500
     aaaatcgcaa agcatttcaa cgctattctt cttttggatg aagccgacgc gttcatggca    181560
     agtcgtaccg agctccatga tagccataat cgtctggtcg ctgtttttct ccgcaagcta    181620
     gagtattacc gaggacttct tttcttgact tcaaaccggg gtatccagtt tgacgaagca    181680
     attctgagcc gaatccatat gaccattgag tatgaagatt tgacaagaga cttccgtaaa    181740
     ggcctctgga gaacctcttt tgtccaaagt ccgaacactc caaggtcctg ccgtggttga    181800
     ggaggaggac attcagcgat tggaatcttt ggctctcaat ggacgagagg tgagtttcat    181860
     actactgggc atatatcact tgctgactgc catgaatcag atcaaaaata tcgcagcagt    181920
     tgcacacgct ctcgctgagg cagatacaac gcaagtcagc tataaatact tggaattagc    181980
     cgcgaaatcg aacaagaaat tttccaagga gtttggcagg cagggtcctg tcgacggaat    182040
     gtatgtctaa cggcatgcat ggcaaacttg agcagataat tccgttgtca aggtttcaag    182100
     caacccggga catttaccgc gatattttcg gttcatatac ggcagtctta gctaggtatt    182160
     gaaagtaaat gaacgtttgc gatgctttca tgatggtata tcattggaaa aagcctcaag    182220
     ttcggaagcc cggctcgcat catgattcag tgatgtcgaa gcatatatag aaggagcgca    182280
     tttcgcctcg gaataaatgg atgacgacgg aaatgcgggt atcaagagta agatagctag    182340
     tttaacaggt agaaagtgga tttccttctc acgacacgcg aagacgtttt gcgtcccctg    182400
     tctcagctcg atagtcgtcg tcttgctgcc cccggtcgct gcagagtcgg ttcgatgatc    182460
     aacgcccgcc caagctcttc attccaaagg cactgtctcg actaagatct tcatgtatta    182520
     tccttatccc gagggctttg gtttccttgt tcgatttgtg aatctaacgc tgtactcccc    182580
     tccccccagg catcacgggc atatgaagtg atctgaaggt gtagacgtaa acgtcaactg    182640
     acgcgtggcc catgggtctg ggggtcgtca tgagcagaca gcagttgagc tggacagggg    182700
     cttttttctg cttttccctg ccccgacgcg atggccacgc caggtattgc cagaagttga    182760
     ttcaagaacc cgacggcgct tcaacaattt cacatcctcc aagtcaatga caattaactg    182820
     gccactgagg tcatcccaca acatattgcg ccactcactg tcgttgtgga cgactccgta    182880
     ggaccggagc acggtcagag ctttcttgcg ctcctgattg aagaaactgg aattctcgtc    182940
     attaattata tgctgaagtc gcgttcccga ccagctcaag accatcatct cagccattaa    183000
     ttcaccatgg taccaatagg cgacccgtgg ctgaaaggat ccaagacaga cggggatctg    183060
     atttccttgc aagctcctga ggtgacgata attgttcgcc tccgcttgaa ggcgatgctg    183120
     cttctccact atagtagctt taatgaccac agtgtctccg tgtgatagaa gggtagcttt    183180
     gacgaggtaa cccgtcctac cacagacgtg gagttgttca aacccatggt ttcggtttcg    183240
     ggcaagttga caatgaagcc ggtgtgtcaa ctcttgcggt cccatagagt gtctctgtcc    183300
     accgtggagt ctccagttgg ggcattcttt atccagaggg tctcggttga caatgccgcg    183360
     gatgcaggca attgtgcagt aggaccttgt agattgcccg tcttttcgag aggtctgttt    183420
     gttgtcccgt ccggctcgtg tgctttcgct ttccttaatc gattggcggt tgttgcctcg    183480
     gccgcggctc gacctgctgc gagtcgctgc tgcgatggac ggcgaatgcg attcttcatc    183540
     actgccgctg ccttcggtcg acgaatgctt cggagtagac atgcctggtt tgcagcgagc    183600
     acgggatcgt gtattgtgtc ttcgcctcta ctttccagtg cgagggtcga taattggaag    183660
     ttggcgggtc tttacggaga gtctcgggga tttttctcaa cacatccaga tattcgacct    183720
     cccaggtctt tagcttgtcg tgtgccgcat catgccactc ttgagacgga gctcggcggc    183780
     tagcgcttga agggtgaatg caagcacctg accgatggcg gtccggtgga ggtgccattc    183840
     atcgtccgcc tgtacgtcct gattcgggat acacatgaaa tattgaacaa ttgtgggatc    183900
     atcatccggg atatggagaa aaataaaagc ctcccccgtg cagatgtagc cgtattgaac    183960
     cccactgtcg atcatatatg agaatatctg agtgaccaca gcggcgacta ggtaggtggc    184020
     ataaaactca aacgtgtcgc cttcctggtc aatgacatcg cgagccagat ccatcgggtg    184080
     tagacccgcc accaattcgg ggattgtcac cttgtgcggc gctttgaact ccactgcata    184140
     cactggtatt tgtcgttcat cagccacaag atgcacgcag aattgatcgg cgcgccgatt    184200
     tcgtcttcgt gtagtgccgt ccccctcctg tctctgcgcc gctcctcttc cccttcctct    184260
     gcctcttcta tgcctagtgt tcgctggtcg ttggggtgtc cgcgcatcct gaagattcat    184320
     tttctccaag ctgttctcca gtgaagattc tgatgggttc gcgcggtcat agaaggtgac    184380
     tcggccttgg attccaaact catgtcgaag gggttcatca tctcgcaacg ccttaatgac    184440
     attttcgaca aaattatcca ccgtgtctcg ttcaaaattc cgaagagacg cttccgaata    184500
     gatcggcctg ttctggatat tcgtaacgac ataatcgatt tgggtatcgg aagggaatag    184560
     tgggcgcgag gtaaaggtat cggtgcggtc gaatttcctc catatttgct cttggagttg    184620
     ggggaagtca agccaaggga caatgcgctt agggtaaagt cggttgacgg ggtcagtcgc    184680
     atcgccctgg gtcgtgagag tcgcattcgt ctcaacccgg atcgctttag acagagagtt    184740
     gtggcagcga tcgaggaggc ggaatagtgt gttgggttcg agtcgccgtt cagcctcacc    184800
     ctggaggcgc tctgcttctt ctcgcgcctt tttctcttct tctcgcgcct gtctctcttt    184860
     ctcttcacgg cgctgtgcct ctgctcgtgc ccgtctctcc tcctcaagct gacgtcgtag    184920
     ctcggcgatt gtttcttcca tcgcttgttg aaatcagtat tcagcaaata ataaaatgat    184980
     gcaactcgaa gtcaacatag tagagggttc gctgtctggc gcgggggagt gggccgtcag    185040
     ggcggaatgc gtcgagatgt ttaccaaacc agcttactca ccccattcgc ttgagccgat    185100
     tcatgcctca ggcaccaacg tcaacaacac gttttggcct ttttgatgtg ctgacgttca    185160
     gagtcctttt ttcctggaat atacgtcgac tcggtggttt cggattacct agagcaggca    185220
     ttgatcgaaa agctagaggg atcaatcgag ttaattggtc tacggaggcg tccgcatgtc    185280
     cgactagtcc gatggagctg ggccgaaccg gtacgcttgt gcatgagatg gcagccatgg    185340
     taaatgatca cattagcctc tttgtaaatg tcagtaagca ggaagatgtc aattctgcgt    185400
     taacaccgtt ggaccgatat cccccaatgc atgcaaatag gcgatgaaac tcataccaaa    185460
     caagccaagc cagatagcca accaatgact tagcttggct gacataatcg gttgcgcgtc    185520
     gctcaaggcc cactcccctt cggtcttccc tatgtccctt gccctctcac tcctggttga    185580
     ctcttatctt taagacaatg tccgcatcat ccgccttact ttgcgctgat attctggtga    185640
     gtttttgctt ggagttagga gaaagaagct taccagtcta tcttaagctg tttcctgatc    185700
     aagcccacat ataccgccgc tacacaagct ctcctggtgt gagtaacctg tcactgtgac    185760
     ctctatatac tgattatttc agttcgcaca atcattttca atccatcttg ctgcttttgc    185820
     gagccttgat caatctacaa gggagaaggt tcttgataat gcgcctgcca ttctctcctg    185880
     cgagatcaaa gagcattgtt ccaccaagct gataggttcc tttgctacac cgaatccaaa    185940
     tcctggcgat atgggtgcga tgaatgaatg caataaatat aagtctttct cgacgggtag    186000
     gtgctcatta aagatttaca gcatcatcgt ccagttcagt ggtcaggatt aaacaaacga    186060
     catcttgtta acttctacag atccctgtct agtgtcttct cccctggatt attttcccta    186120
     tgatatggat ttcactccgt ggttacagtc tgaccaggag gccagcgaac caatggaaat    186180
     agatgatcag caaagccaac cgatcgaaga tgtccatgat gaaacaccaa atgctgcact    186240
     tattttcgat acgagcgaca ttagtttgaa cgcaaatacg ttacctccca ccgaatccga    186300
     aaatgcgccc tgtgtcgatt tgtcaaggct gaagtcgtcg gaggggcaag agagaatcag    186360
     tggtttaaag accatgatcg aagaatccct ggagcagatg catacgaaat tcgtcgaaga    186420
     tggaggtaaa gagactggca ttggtaaggc ttttgcttgc attatcgacc atcgaccaga    186480
     gcttcttgag aaagacgaaa agacgcggaa tttcagaaaa ggaagtgacc caatagcaaa    186540
     attcttcaga atcatttgta aaaggttcag ccttctttcg tccgttatca cgtccaaggt    186600
     ggttgaggga ccgggggggt tgaacttgct acggatttgt tgcgagtggg tacttttgga    186660
     gactttgtgt tacacctcta taggaattgc tccccaccgc agatggctgg ctgttccggc    186720
     acaggagttg tattctgtgt cgcgagaagg tgtagaagct ttccagccgc ttgctatgaa    186780
     cggcgcaaag ccatggaaag acctccgcaa ggtggactcg gcacctcttg gctcatggac    186840
     tctgtatcgc ggatacattg tccacgtaga tactggatgc agcagctgtt ttgccaaagt    186900
     atccgacata aggtgcctcg ccgacggacg ctatgctgtt gtctatacat ggctttatac    186960
     gagagagcag gtagctgagg aattggaagt cgatggtgct ttatctccac gttctcgagc    187020
     tcatcttgat aggatgtggc ctcataagga tcgctacgtc cacatgttga gcactaatcg    187080
     gacaataact ctctgggata ctgccattag ccgcgctcca gagagtgtgg tgtctgcgct    187140
     ttgctatagc gcaatatata gcacaactcc tacatcgcgg aggatctgga atgtcgacaa    187200
     ctcgcgattc aaatggatga agaggattct cctccttgaa gcccatgagg ggaaggtcgt    187260
     gaagtgaaca taatattttt cataaacata aggccatgtg attagcaaag tgaggattaa    187320
     tctaagtaca tatatatata tatatatctg aatgacttat atgttatgaa cgcagtctga    187380
     cttctcacta gcattggcta tctgcgatca tggcgtaatt gacaagttga aaataagaaa    187440
     gataagtgag tagaggtgaa atgtgttgca aatgaggttt cggagacttg tttatcacac    187500
     tcgcaaatgg ttgccgaatc cggaagagaa acttgatccc agatgcgccg aacgctaacc    187560
     cgccacccac gctgagtagc tgcccaggac gctagttttt cttctgctct caaccatgcg    187620
     gagacggatt ctttgatctt ctgatggacg agagaaattt ccaagcaacg ctcgagccac    187680
     tcaaagcatt tcgcgcgtgc ctcgggcagt aagctctcgt ctaacccagt ggcaaggagc    187740
     tctgaaaagg cggttagcga tctcgatgtc gtgaaatctt tggctatcaa gaatccccct    187800
     tgaagggtga acgttgcgtg aagggatgct gcaggaatgt gtatcgcatg tgccgaggtt    187860
     gtctccacga ccacacaccc ttccagttcg tgtacgagtc gagccagtcg tagacgctgg    187920
     ccgtcgacaa ccttcattga tcgcagattg tgagtagtgg gcggatatag cagccatatc    187980
     tttcggcaat caccaattgg agttgcaagc ccgtcggtac cgtaatctgc tcgatttagt    188040
     tggcaacgtc ataagtaagc acgctcaact taccaatatg caagtccaca aaagaatact    188100
     ttggcgtcat attaacctgc tcgttggatt cgtaaaaagg ttctgcaacc ttacaaacat    188160
     ccagaggtac gcgaaattcc agattttcta tgatgggcaa cctcaagcca gtgagaaata    188220
     caggcttatt tggatcagca tctacaagct gagagatcgc cacgttggga tcggcaactg    188280
     tgtcaagctc cccttgataa ttgacacata agtgggactc ggaccgaacg gcagtagcag    188340
     tatgattcct ggcacctatt ttttgtaaag tttgcgtgac taactcacgg acgagaggca    188400
     cacggcctcg ccagctttgg gaagagtcaa gcagttgtgg aatagaagaa gttgaagata    188460
     gccaaagcgg tcgggtcttc tctgacatag aatccaaggt tgacgggtct ggaatcgaac    188520
     caatcgcgaa gttcggaccg acttcttcca agatctcctt caacatagct tcgcagcttc    188580
     tatgcgggaa caagtctatt gtttgcgata aggaatttct ttgtctctcc ggtggcgggg    188640
     caatggggac attgttcccg ctgggaagac caaaggtacg tggaagacaa cacggcgacc    188700
     tgctatctgt aagaagactg cccgcgtacc aaaatacaag aaggtcttgc ctgataccga    188760
     ctgcgccagc acgctcaggc tcaacgaaaa tatttctctc gcgatacttt ttttgtcgaa    188820
     gatgtttgcg cagacgactg gcatttgaga aaacgtgccc acaatacggg caaacgcaca    188880
     tacaagatga tactcgtatt gtgacgtttt ctctcggcca ctgatggtag atcgattgat    188940
     gcgaggtaca tccacacccg gggtataact gagacatgga tctagacata ggcggttgag    189000
     ggatgattgg gggatgattg ggggatgatt gggggatgat tgggggatga ttgaaggacg    189060
     attgaaggac gattgaagga cgattgaagg acgattgaag gacgattgaa ggacgattga    189120
     aggacgattg aaggacgatt gaaggacgat tgaaggacga ttgaaggacg attgaaggac    189180
     gattgaagga cgattgaagg acgattgaag gacgattgaa ggacgattga aggacgattg    189240
     aaggacgatt gaaggacgat tgaaggacga ttgaaggacg attgaaggac gattgaagga    189300
     cgattgaagg acgattgaag gacgattgaa ggacgattga aggacgattg aaggacgatt    189360
     gaaggacgat tgaaggacga ttgaaggacg attgaaggac gattgaagga cgattgggag    189420
     attgggattg gggggagata atttatccgc atgcgatcct aaaatacaat aggcggcctc    189480
     ttcaggttag ctccagtccg acgccatccc tcagtggttc gctgaggaca aagcggacca    189540
     ctctcagggg tctgggatct gacgaaccaa ttatactcct ccttagccgg cggcgatgct    189600
     tggcaaggga tttgtggact tcttcccagt gaaacttagc tctatgttgc attggaaatt    189660
     tcgggcttta cgtccctctc ccacttggta cgccttcttc acaggaatgg tctcttttct    189720
     ggacacggat gctcgtgagc tacttcaatt tgccatagaa atgtgcgcga tgcagaaaaa    189780
     gcaggtcaac acgcgaggac aacgccagtt cgagtccgcc tcattctatc aggccattca    189840
     aagcaatggc cggacactaa ataagcctgt ggcagtcttc actgagttta cggtcatggg    189900
     agcagaccca tcattcatga tcacttgtct gctagcaacc cggccttcaa ctgtcgtcac    189960
     aacttaggaa ccacgagatt tcggccccac atacgcggcg ccgatcgctg tagcttacgg    190020
     gagctctgtt acagtaagga aaggcattat tatttgtcag gatgaggaat tgatatactg    190080
     gctagtactg agcatgtcca atagaatcag gtgattgatt gtacagagga tttcgaaaac    190140
     agattacccc ccagacacac acgctttctt tcccagcgct ccactaagat tgcgctgagc    190200
     taattctggc tagacggagc cccttcccag aggcatgacg ccgtatcatt ggctgcggga    190260
     gaatccagaa ccagggcgat ccggactaag cgccaaagtg ggtctgcggg agagtaaaca    190320
     tgtgcctggg gggtaaactg ttttcgaaat ccactgtagg tcttaagatc ggttgaacga    190380
     tctcagggga ctatacaaat aagcctcggc gtgttacaaa accgtacttc cgaatgtgcc    190440
     cggaataccg tacaaatact agggggaatc gggtgaacga tgaataagcc tgtcccgaag    190500
     ggtcctagtg gtatttgacc actccctcag ttcgtcattt tttttttttt tttcgcataa    190560
     tactcctatt gagagcgcga atgggaaacc ttgccctgtt ccaaagttgc gctaagatag    190620
     atatatccta ttaccctcgc ccacaagctt ggcacccgat catattctcc attgcctatg    190680
     catattctag ttcatcaaac acagcacttg tctttcataa tctagagctc gttggggagg    190740
     tcgattcgcc tgtatgaggg tgctgaatat tcctcgggcg cactagtaaa gttgcgactt    190800
     tcttttgttg acccattgtt gtttttagtt aaaagaacgt accattgtgg atttaccagt    190860
     acgttcggca tgcacctggt ttctgtcata taactttttc cattttataa cgtaagatat    190920
     tataaagtaa gtatgttaga ttattagagc atatagaggc atttcaggta aattgttgtt    190980
     ggtgaggtat gatattgtaa gttatcgcaa ttattatggt gttttggggg tggccggttt    191040
     cttgtgaatt atgtcgaata ccaaggtgga atatatggat gcaatgagat cgataccgcc    191100
     cggatctaca tggacgggca gcaggaagga aggcttcacc gccgaagttg gcaaccaaaa    191160
     cttatccgct agccccagga gcgcattgtg cagccaacct ccaaaaagat cttgagacgt    191220
     ctctatcaga ctacgtacgc aatcagtcga tacattttac ttccatgcgg ctgaccgctt    191280
     ggtgcctttt gatgaaacct tgaagaagtt ggactctctt cgtcagacag ggaaatttcg    191340
     acgtctgggg ctcagtaact tctcagcgta cgagattgct gagatagtag tgctctgcca    191400
     cactcgtggt tggatccgtc cgagtattca tcaaggggtt tataacgcca tctgtggatc    191460
     gaacatgtcc tcacggctcc aaaactcctt tactaactta atgttacgac agcacggaat    191520
     ctcgaaacgg agattattcc agcctgtcgt cgctacggcc tcgacgtggt ggtctacaac    191580
     cccttggcag gaaatctttt gaccggaaga tacacgtatt caggatccga agacaatgca    191640
     ggtcgataca gtaccaaggt cttcttgggc cccatctacc gaccacttta cttcgaagac    191700
     aatttcgagg cactgtgatt ggttcgatcg gttgcagcaa attaagccat cgattggtca    191760
     ctatggtaga gccatatgtg cgttggcggg gcttgctgcg tacacttgtc acttaataac    191820
     aaatgaattc tgtacgccat ttccagagtc atccaaatgc cctggcatct actgtaggcg    191880
     gagagcatga atctggggag gcaaaaggca ggaccaacag aatttgagtg gtactaacaa    191940
     caacgttaga atgtagttct aaaagttcct gagcaatcaa agaaagccaa tgagcagcaa    192000
     tcccgcacgg catatgagtt caaggtcaag tctgaatctg gataatattc agacggacca    192060
     agtacgcgtt ggttccattt gctgactgga tgtcactgct ccatgcacaa aatagattgg    192120
     cgacaattcg taggccgtca gggttatcaa aatctcgacg gggataaagc gcaaatccct    192180
     ttatgagaca attgtgccct gaatatactg atttcttgca taatccgact atgcccatta    192240
     tcagggtgta gcctgctaat tacttgctcc aaggtctgtt cggtggaaag tgcggtaatg    192300
     actcgcgcaa agcgggccgc atctattatg gccactttct caagccctcg tcgcctcatg    192360
     tctttgatgt tcatcgacac tatcgtagcc ggggagccga cccccagccc gtatggaatg    192420
     acatcttttc tgagagcggt caggccacct atgcgacaaa agtgaccgag acggacaaat    192480
     tgttggaccg ccgtcccgcc accaatattg gcgaaatcac caacagtaac atggccaccc    192540
     agcagtacat ggttagccat gacgacacca tttccaattt ggcagtcgtg accaacgtgg    192600
     gagcgtgcca tcaacaagca gttgtttcca acaagcgtga gccctccacc acccaatgtg    192660
     ccagtgtgaa tggtgacatt ctctcgtata gtgcaagagt ttcctatgga caatctagtc    192720
     gcttctccac ggaatttgag gtcttgcggc tcgtgtccaa ttgatgcgaa ggagaagacc    192780
     cgcgagtggc ttccaatggt agttctccct gtcacaacaa catgtgaatg gagatgaacc    192840
     cctgggtgta gggttcttgt ggcccaacca agcaatacgg gccgattttc acatcgggtg    192900
     ctaaagtcgc tccagcagaa acgacggcag tcggatgaat aaatgctgat cgcgtaagct    192960
     gacccaacct cacaccaaaa tcaaagaagt ttggtgtcat cgtagggatc aagaatatag    193020
     agtaactaat gtcatttaga tgtgaaaaat agaaccccca ccactgtctc atcactaggg    193080
     ttatgcttgc acagtccgcg agaacatcga ttacaaagca tgttacccaa gcgcggaagc    193140
     aaaagtgtcg ggacgtggtc gttacagtac gtactacggg catagccaat tgggtacctg    193200
     agagtgtcgg tctaagaact atcgaaggtg cagactaaaa aagggggctg gggcttagta    193260
     agatcgttaa gagccctaca atcatggttg gcgtactcta aactctgctt gctacgactc    193320
     ccggagatta aattccaagt ttcttcatat cctcttatca atttccgtga gaaaaaggat    193380
     taccggaaaa ttcttacctg ggcttgaaag tcctccaagg cttatataat aattgatggg    193440
     caccagctaa atcccggctg cccttgcctt taattcgcta cgtctgtcct caactttcgg    193500
     cctattggct gcatctttcg tacgacgccg tctttgccgt tggatactct gcttttaggc    193560
     ccaattttag tgttggggat tttgggcgtt atgtgctggc tgggaatttc ctgtttaacc    193620
     ccaattttcc cgaacccttg tcataggcga ccccccaccg ctggcaggtt tgcagatata    193680
     gcgataaaac caataagctc cgaccgtatg acctttggcg gcgcatgcgc tgaaaggtat    193740
     tttcgatgaa atgggagaaa atgaagattt ccagaatctt gtctcaaata tgtatgggca    193800
     catctggccc taaacctatg gtattacata gcccgatggt gtccgcacta gccctgaatg    193860
     agtagtgttc ctccgataga gtccaacatc tcacaggaca cgtcggtgag gatagggtga    193920
     gcgccgcttt agcgtcgcgc gaccggggtt ggcaagggtg agtgctcgtt actgccaagg    193980
     acctagaatc tagtgcctcc tgggctaggg ttcctgtgag ggtcaatctg atgatcgaat    194040
     tctgccaact ctatatctag cagacatgat ggtaaaagca aataaagata tttgtgaaca    194100
     ctgaaagagt tacaagtaat cactgactac ctacaagctg cagggcgtcc gctcgtcgca    194160
     accacatttt tatgaccgct gcaacaagac tgacagtgct aaaggtgaga attgtaacat    194220
     tgactgtcct atatacgcgc tttccacagg atcgattaat atgatgcatt ctccgttgga    194280
     acgatttatt gtaaatcaac gacaatgaat ttgtactgcg gataggtagg gctgggctgg    194340
     attctagcaa acaaatgctg gagaagaatg atgacacacc ctgctagatt actgtcatct    194400
     gccggagaat cttcttcgaa ggctattgat gagccgcgtg acaggcggag gcaggaatga    194460
     gcccccctcg cctttatccg ttacatcctg ctccaggtct cctgtaggtg ggatttccag    194520
     tatcactgcc tctgcctggc tgttttcgtc gtcccagagc gctcgtcaac actcatctcg    194580
     gctgaatccc actcgtcatc gctgatcggt tcatgccttt ctgcctctac ttcgaattcc    194640
     tcccattcat cgtcactcgc catgtcatgt tccacccagc tgatcgattg cttccctgat    194700
     tcggatccct ccgagtacgc gtacatcacc aaatctcgca tggtcgactc atccagagat    194760
     cccccacgag tacggcagat gttttgtgca acggtgagaa gccgttctgt gccagctcct    194820
     gtagccggaa tggagagtag atcgcgcgcc agtcgagtga gaacaggcca ttcgcgttga    194880
     tggtctttcc agtaagcgca tggcgagata ttgagaaccc ctgttgcgtg tcagtagtca    194940
     acaggaaata tactggatcc atgagaacat cggttgccat cgagaacata tccaggacaa    195000
     tgacgtccga agggtaggct gcatcggccg aaggacatcc cgtatccagg aaagggtttg    195060
     cgatccctcg atcatctcat cgggaggcag gtggtccaaa gggctgggat tgagtaacaa    195120
     gacggacggg aaatcgagtg acccagagag cagtccgcag aaactcagga agctcgcctc    195180
     gggggctctc ccttcctttt gaaactcacg tgccataatg tataaaggat gcgattcatg    195240
     gagctctagt cggcgagctt gtcggagccc ctcgagctga ggttgaatca cagccgatat    195300
     caaatcgtca acgtaactga ccgatgattg tcgatcaagc ttcccgaagg catgcctcaa    195360
     atgggttaaa cggaggagtt tgaggcttaa cagcgcctgt ctcgcctggg tctgtcaatg    195420
     aaggagccgt gagggagcca tttagaggat caggcaaatc cacgtccgaa ggtagacagg    195480
     atggggcatt ttcagaatgt gtattgtcta aaactgatgg acttagattt gatgatgttg    195540
     tcgactacga tataactggc acaccttttt atacctcgtt ttatacccgg gggtttatgt    195600
     ttagcaacct ggatgcagcc agcattacct attcaagagc gatctatcac tacgcatccg    195660
     tactgtttgc ttactatgct actcacaatt accaccgatc acaggaatac acgacgcatt    195720
     gagtagtaat ttacaaggag ctgcacagct ctaccatggc cgtggtttta taatgagctc    195780
     tagtggaaac aacattttaa ttcgaaaagc tgcttgcgct gatcgatacc acctaccacc    195840
     gacggggcat tttcatcatc cagattttgt ctcagctgga gcttgaacag gtaagagccg    195900
     caagtgtcat tggtatggtt tccggtgcca aatgaacccc gtttttatcc ccaatcggtc    195960
     gcgtcgaagg agttctgact gtaattgaaa tgagcctcgt gcccagctgc tttcactaat    196020
     ctagacggta ggggcctatt tcaacatgat ttcggtctgg taggttgaaa gtccaagaat    196080
     tctggagttc tcaaggcaat gaaaacaaat cacaggcgtg ataatatgaa gatctcgtga    196140
     acaatatttg agggtttaga cgacatatgg gtactgggta ctaaaaggat acaatctcag    196200
     tgaacgaagg agatattata taggccgtgt atacaaagcg ccttgggttg gaccctggta    196260
     acagctaatc ttatcttgcg ctacgtgaga ggaagacgat gttgcactaa aattgccagc    196320
     cttttcagct tatgtggctc tttgacgaat acgattcatc ctccgaatcc gatattcaga    196380
     ggcaatgtca aaaccaatcc aattgcacaa ttcctactaa gcagacgccc gctggctgtg    196440
     gatatgtagt cagatctcgg tagtaccaat gtgcttgtat gcctctataa gtaatccgtg    196500
     ggtatagata atactcaacc cggtcccacc ggcgaacctt gcattactgc gcaatctcaa    196560
     ccgtaacccc gggtaacact tttattgcaa ggttgcataa gcgggggtat actattttgg    196620
     tcatgtagaa tccgctcttg agtattttgt tgttctgtat gacgttcttt ggctacttgg    196680
     tagggccagc ttcgtctgga acgaaatgaa gaatccgcca aatgtaacag taacgtcagt    196740
     cctttttcaa ctacacgaga attagctcac tccacgtttc aatacttctt ccagggtgtt    196800
     ggaagctaga gcaattgact tttagcaatg agcgtgagct tctacaccat catcaccgtc    196860
     tgaacaacgt atgggatgga agggtagata tgagaaaatt caatactacc aagtaagaga    196920
     aattgtgagt gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg atgtgagtgt    196980
     tgatgtgagt gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg atgtgagtgt    197040
     tgatgtgagt gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg atgtgagtgt    197100
     tgatgtgagt gttgatgtga gtgttgatgt gagtgttgat gtgagtgttg atgtgagtgt    197160
     tgatgtgagt gttgatgtgt gttgatgagc gtggtggtga gcgtggtggt gattggtcgg    197220
     gcggtgaaaa aggtggtcaa cgtctagacc ttgccatcgg tccatgccac cctcagatta    197280
     tgtaagtttc ctgaataggg ggttcaactt ttggaaatct atcacttgtc acctaccccc    197340
     aataaccact agtatagcag ataattgatc ataataaagg tgaatcctag tatgtagtat    197400
     aactaatatg tcgtgtttat aataaattta ctgatgcgac tggtaggcat tatattgtga    197460
     gtggttttgt aggttcagca tgttttatag tcatatatat atttgcacgc aatgcagacg    197520
     catcacaatt tctatgcatt tcggatcaca ctttcattca cttagactca atagtccatt    197580
     gcttttacta ggatttgtta tagctgaaca catccattgt atacctttct actcaaataa    197640
     cctgaatacg tagtactata ggacatatgc gtgcgtggct aaacattata aaattatgaa    197700
     aattcagtga ccgaagtgct tattagtaag caacctatgg gcccattaaa tgccacgggg    197760
     ctacggtcaa ccgcccgccc gcctataggc aggggcgaaa gtaattcagt gcgaatccat    197820
     gggcctcaaa gcccgtggcg aggtctatca atgtctcacg gacgtagtac ggaggattcc    197880
     ttgccatctc acccacatga taaatgtatc aatcactata gatcctattt cgtaatgatc    197940
     actcggtgaa gttggcatac agcctcaatc cgatagggat agtagatcca ctggttcgac    198000
     tatgaccaag caatacgccc aagacgcaat acgcccaaga cccacgtgta gaagcatgtg    198060
     atgaggtgcc gaacgaatgg cttgagtaaa attagccatg cggtaggctt tgtgccttgc    198120
     gaagtcaaag ccatcacttg aggcggcgat tgagtcactc gaccttaccc taattcagct    198180
     cttatatcct agagcgcaag aatcaaagta attttaccgc agagacaacc atgttgctga    198240
     gagatctgga caagcaagca atcaagaata cccggttggc tcctactatg cctcggcaac    198300
     gacggatcat atttcaacca atcccggatc gaagtgacgg caattgcctt tttggaagtg    198360
     gtgtccaagt taatgcaatc aaccatgttc tgctgataag ggaacacggt tgaaacccga    198420
     ttgaaacccg attgaaaccc gattgagttc tagcagtgcc gtctgaaacg aatttccgtt    198480
     gggtgatatc ccgccggagt gctagtttgc tcgtagtcgt agtagacaat ccggccatgc    198540
     ttccaaaagc aaccatcaca tgagcgttga ttgacagtgg aaagtttgct ccaggatcta    198600
     ggggctagtc caagaggtcc cataaatatt ctgattcgat attgtttcgg acaccaaagt    198660
     ctttacagtg gctgcctggc cgaacagtaa tatgcccacg tgtcctccgc ggcgcggtgg    198720
     gctcgacgaa tatatgattt attctcaaaa aaaccgtcga attaggggat gtaaggaatc    198780
     atttcctgac aagtgcgtga tatgttagga gacgatatga acggataaag gatacgcgcg    198840
     gtcgacttga ctaacctgca gctgcaatga caccccgagt aaatggtatt tgtagacagt    198900
     gcttcggctt ggataggaaa tgcgtgcata agaaccaacc gggtgcacca caacactttt    198960
     gacagccctc atgatgcagc ttcctatatg cccgaggtga ttcttgggta gtgagctctc    199020
     attagcttgt ctgtgccccg atcttaccct ctcgatttgt acctgagatg accaatgtca    199080
     aattgtaggt taagaatgag aggactttgc gtctccttct ccttgcaggc ggacttgtgc    199140
     taacagcctg attgtctacg gaggtacgct catctgctag gaagcaagac agaacatcag    199200
     cattccggtg tctttttcca gtcctggaaa gacaccaaat gtcatccgaa gacaacgagg    199260
     atcacgcatc cgataccagc agcctacgcc atttgaaggt atttgaaagg ttgcatgctt    199320
     agccacaggt atgattcggg tagtggtata ggctgatcgg agttcaggag ttgtatcatg    199380
     tagacaaatc gaacaatgac ctgatactca gaatctaggg agaaagaggc cgaggtgcgc    199440
     gatacgaatc ttctggtgac tcatcgtcga tagtagtcat gtggaaggga cagagagcat    199500
     gcgacagtat ttgtataggg gagctcgagc agacaagaca tttgttcgcg tggcattcga    199560
     cttgagtgat agaaatgagg ctgtcctcct gttgtacgat ccgagtcagc aagcattgat    199620
     cttggacgag ctgtcgtagc gtacctgttc atgggaatcc caaagtgcgc ttgagacgtg    199680
     acgatcagtt tgcacaatga ttatatcggc ttcacaacta gagcacttac agctctctgc    199740
     aatgcagtca ccatccatgc cacgtcgcat tcaagctcat cgcaatcggc tgtcacttaa    199800
     aaagccgcgc tggggtgcac aacccaattt gttgagacag taaatgcgcg tgacgaaccg    199860
     acttgcgata agtattgcac tttcatgatg gacgaatgtg tcgcgacgtc agaggttcag    199920
     gaactccaca atagtgtgaa ggcggtgggg acgagggcgg aagacgcgat ggagcacgct    199980
     cgacgccccg ccaccttagt ctaagtctcg atctgtactc taggatccag aagtagggtc    200040
     ctaggagcgc aacaggtccc agatctaacc aaggtgttcc cagagccagt ttgtattcag    200100
     tcagggatgt agaggcaaga tcccaggagt agatcttgat tttcctggag atttgtaaaa    200160
     gccccaggag ctaaggtgta tttcccaggg gatatacagc tcccagaaat gcttttgagt    200220
     ttcccagggt caacatattg attcccagag tcaatataac cagcatcgga gtttgccagg    200280
     gtccttcgcc aacccgagat atgttatctt ctgccaacag tctccgtctt gacgcgacac    200340
     gcaccactgt gttaaatcca tgtctacagt tctttggcac caccgttggg tataaatatg    200400
     gtttcgatct aaaaaatatc ccaaaattaa gcgaaactgc caacagttct tgggggtgca    200460
     ttggcatcta gtacttgcaa agatgaaaag gtcgcgtggt tttagttttg gtgctctgcg    200520
     agttcgaaca ttcagaactt catttgcatc atttctaaac ttgctctaaa actccatacc    200580
     acggctatgc tctatgttgc tgggccgaat gcggtgtgtc tggtcacgtg ccttcacccg    200640
     tgattgacag tcgcttcgct aatttctcat tcccgtcaca cctccgctgt aaactaagat    200700
     caccttcgac tggtgtttag tcgtgctgac cggcggggtg gtgcagacgt agaagggcct    200760
     cgtggtagat gagctcctag cctagccgag cgacgggggc cattctccac actccgctcg    200820
     actgatctcc cttggggtcc cactgagcgc tgtcgcagct gactccgact cgggtcattc    200880
     ggtgatgaat tcctgatagt ggcaagttct ctcccggcag atgattcagt tcccgtgtgg    200940
     atatgacgtg tctcagcatc cgacgattgg actcgtattg ggcgaaccaa ggcgtctaaa    201000
     ggcccttcat ttcgactgta ttaatcagca tcttgggtat tgcataacgg aaccagccct    201060
     acttaccaca cacagcatga cgtcccaaaa cctgtacttc atttttccag ccactcttcc    201120
     gcgcaggcca ggtggggaag cgccttgcac tgacagcgca agatcacact ctcatttccg    201180
     agatcttcat cctcgtctag acgaatatat agtagatgtc gtcgacctcg tcgcttaggg    201240
     tgagaccttt gagcatcaag tcttggacgc cagcccagat gttagcgacc gatgtcagga    201300
     tagcgggttg agccggcgaa acatgccatg gaaaactgtt cgtccgcagc attgcggaag    201360
     tgacaaatgg attgaatggc tgcattggct cggggtcggt tgacagctgc acggtgggtc    201420
     ttgtctgagc ctatgagatg gtggctggtc agtgttggct gatgcagggc gtctcctaga    201480
     ggctgacgat gtctgaagct gtccctggtg tacaacaact gatgtagagc ccattatgga    201540
     gctatgtggc actcacgcct ggttgcggac ggctgcttcg tacactgctg gctaactcgg    201600
     tcggcctgcc gttgccggtg ccatctcgcg cagaggaagt ctctggcgac atcacagagc    201660
     ttggattaca acgctgacaa gtcaaacggc tctctggcga gagtggtcaa cctctgatgg    201720
     ccgatcttgg tgtcttcaac ttggatcgag ttcttgcatg gctcgccttt tttcgtcatg    201780
     ccgcaacagg agcccggacc gccattgggg ctgacatcta tctcacaaac aagaaacgga    201840
     ctccaaggca gcatggtagt tattgaggtg gtcgtcgaac gcagaaaatg cttcggattg    201900
     tggtggtgta gggccatcac tgcggcgttc cctcgccagc tttatatgcc atcgcgtggg    201960
     ctccttacct acatggctcc gtggctggca tggaacacct ccttgaaaca gtcggcactt    202020
     cgaagaaggc attcacacgc ggtatgcgtc actgtagggc caatcagtgg cctgcgagaa    202080
     gggatatcat tccagatcac tgctgctcaa atcagctaca cttgtggctg tagattgtga    202140
     tgaccatgca ttggcaaaag gattggctat tatgggtggt aacatagtcg gcagatttgc    202200
     gagtgggatc tatacatttc gaagtgcgtg taggttgtgg tttgcttcaa cgcttatggc    202260
     gctagatgcg agtcggtctc ccagggccat gtgacggttc atggatgctt gggttttacc    202320
     actaggtcat ttggacaaaa aggcacaatg tttgatcagc gaccaaacac ccaagatact    202380
     atatatgctc gatctctgat aggccattaa cacactacca ggaataattt tggcgttccc    202440
     aggagctaga ctccagagtg tcagggatat aagaagcata cggaacggat ggagatacga    202500
     tttgcgcggg acccacatgg tgtgttcccc tgaacgcgag taagctacct tctttttgct    202560
     tcctcgcgct acgtcttgta tctagagtca actatagttg ttcttaggat tcattgttca    202620
     tcctgaaata ctatccacct ctatttatac gtgagaccct cacacatttg ggaacaaatc    202680
     caccggatct ctgggagatg tcgcactccc gggaccctaa ttctgggccc gagagtcagt    202740
     atcttgcctt ctgaggttca cggaaagccc tcacaagaca ccctctccag acctgcgcac    202800
     aaatctacgt cattcgatca ctcctagaag gccgagctat agccccagaa accttatgat    202860
     tccaggagtt aataaagctg tcaacaggaa cgtgacattc gctcccgagg tggtgggaaa    202920
     aggcatagaa tctgcgtcgg gtttccgggg ggctatatga ctcctcaatg cggcttaagt    202980
     gcccccagaa gccgtaacaa agccactggg agcaggagga ctcccaaagt caagatgacg    203040
     aaggtctatc agatttacca atcaagttat ggaaatcccg tcttccacag cctgacaccg    203100
     ctttgattct agaaatcttt tattcgaaga gtagcgcgca cacagatggg taagaagacg    203160
     gtattcctgt tgtctgaacc agcgaatcgt accgagcatt tgagagcatt agccttgctt    203220
     gaagtggaga aacagctact ggcatagccc atttcaccac cgagttattt ctttaaacac    203280
     tatcccttgt ccgcttcctt ttgataactt tataacgagg cccaccttga gaagttcttt    203340
     tgtgtaaagg cgaaggaagt gaggggctgt gactcatctc tcgagccggt cgtatggagc    203400
     taggctgacc acggatgaag gaatcgtgat ggtaggcccc cccagttttg tgaaagccat    203460
     agtaataaag ccgccgaata agagattggt agcttttagt ggacatcttt gcaagcatgt    203520
     gtgcaggaaa tatgctttct tcgccgatca agacagattt tccatcttct gaccagcgca    203580
     ttacctccca actgtttgga tcatctagga ttctttcaca tgttagttta taagcacgca    203640
     catccaagtc tgtatatgct tcacttactc gctcagattt tgaatgaagt cagaggtgtg    203700
     taatctgaac tctggccttt tgccatctac atgcccagag tcaccgcgtt gagtagggtt    203760
     ccccacagtg gcatcttctg acagagttcg atcattagag tcttcgttaa ctggcccggg    203820
     tgatccagct ttgctagcat aatggatagg tgcagggatg gtaggtgaat cttggtaact    203880
     tgggcttcca tcttctgccg tgggctctgg atcaaaaact ccctgagttg gaacaaaagg    203940
     ctgagcacca tcacaggtcg gattcttccc ttggtggatg gcgtaatccc cactcgcgaa    204000
     aagttgagac actaaacggt gatgattccg gagacgttgt tcaacaagcg agatttgtgc    204060
     caagactata ttggtcggtc ttagcttccc atataacatc gttaagcaat atgtccaaga    204120
     tactcaccct cgcctattac tttccgagca ttggaaagct cctgcagtgc ggtctcgctt    204180
     gactgaagtt ccttcgtgca atcatctcta tctggccacg gggagagaaa ccgccaaggc    204240
     cgcccagacc gtaagagctt gaggtcgtac tcgggcagtt caacgctgga attatcaata    204300
     ttaagctgcg ttgagccctc aaagtcggga cctgcgaaaa gcacaagctt cgtccaagtc    204360
     aacgacggcc catcggtcac gcatggtgtt gatgttgaga aaaggctctc taagctcttg    204420
     cttaggctaa tgctggccaa agtttctcca cgtccaaggg caatactgcc accctcattt    204480
     attgtggata aatgattcgc caattcggtc gagaattcgg aaacggagac atttgcaagt    204540
     ctaagaggat ttagactttt ctcatcacgt tgagacacga agttgtgtac tattttatca    204600
     atagtttgat ggttttcatc atcggtcatt ttgttaaaag gtgtaggcat aatttgaaaa    204660
     ccacgacttt gagcgtacag taccttaaca ccaaagtcga aagtgaaaaa ggagaatctg    204720
     cgaagtcgta accgatcttt caaattggaa taatgatttt ccgatgcccg ccgccaagat    204780
     ttcaataacg agttctacac tcatgtattc ggtcggaatc ttcggttttg agacaagctc    204840
     cgctggcgac aatttttgga cgaccaagga gattctccgg tccacacatc gacgatatct    204900
     gggcaaaact cgtgtctcct ccttgactgg ctcagatgga tcccttacgg cacttggggc    204960
     tacacggtac aagagcgtca actgttcata gacggcatgc ctgcaatttc aatttgcgga    205020
     ctatctagat tcttgagatt tttaccatct caactacaac tttacgttat ccaatgagaa    205080
     ggcaagtcgc aggccgaaag tggccttaac gccacctagc gttgtgggtg tagaaaccag    205140
     gtatgatctt cagtgccgtt ctcactcctt tgcatgtgta tgtcacccgg tacagtatta    205200
     gaatatcagg cagtagcgag tccagaacac tcaatagtca gtttttacgt tcaacactat    205260
     gatctattgg cttctggccg atatgcttgg acacgcatga ctcccatagg cgtcgataga    205320
     gtccgatgag tcgagccgct ggaaaggcga acttgggatc gtcgcgttcg agttctgcta    205380
     gcaccttcaa caagggttga aagggctcgg tcgccaaagt atatcatgtt accgcttcct    205440
     cttgcgaagg agagagctgc gatggtcagc aagagcattg gcagctgagc cgttccactc    205500
     accattggca catgatcaga agcttcctgc gaattttctt tttcacaaag gaatggggca    205560
     atttactggg ctgctgttct ccttctcttt cctggtctgg cgagctgttc gagacatcca    205620
     tttgtccgca gggaaatgtc aagggtctgg gcaatagcat gcccaacact tcttggagga    205680
     ttttatagac tagttactca ttctcacttc caccatgaaa gtcaatcaac acagtctggc    205740
     tttgcctaga acccaaggat ttttttgagg cactgttagc agtccgttta atgatggtgc    205800
     tggtgtggat ctcgtggtgt tgatggttgg tgaatatacc tatatttagt ggctcactga    205860
     tatgaccagc ccaggagata tatcttcaat cacaacacta tttccacatt catcgaagtg    205920
     ctcacaaatc cgaaaaagaa atacactagg gtttagaaga ctgaaagtaa gaaaaaatca    205980
     aagaataaaa gtatgtcaac actggtcgtg agtcccaaag ttgattccag tcaacaacga    206040
     actggaggcc aagcttcaac aggttgacgg gttgagtacc tgcgcccgcg cgaccgcggc    206100
     ctgaggcttt ccgcagccta gacggacaga accacatacg gcgcagacaa tcaacactcg    206160
     agcgaggcca gaaaatttcc acgttccttc gatgaaaata tgagcgctct tggtaaaacc    206220
     gaagaatgaa cagcttccat tgcctcaata ttaagacctc agactcaaca gtgagccaac    206280
     gtttcttaaa gactcacttt gactcattct caacttgact ccagcttgtt ttctcgctgg    206340
     gcatctaaga tgacaccaga attccgctgc aaatagttgc ggtaggatga agggattgca    206400
     acagacctca cttaggatag gcatcgtgtc caacgtttgc tccctagcag agcacatacg    206460
     tgacaggagc cgagaagcta taaatacgcc ctctccccct gcaatttgtt ccatactgtc    206520
     acttgccgcg caaagtcgag caggccgtcg gtgaggcacc tgataagtct tgcctttgac    206580
     cctactggaa ttcctactgc cctgacgtct atagatgcaa tgcggaccga caagctagaa    206640
     actgctcgcg agattaccac taggtctact atgcaatcca tgctaggcga ccaatcaaca    206700
     agatttgggt tagccggtca aagtacctat gcgaacatct gtccaccaaa tcagtggact    206760
     cactgtcccg cctctggatg aatcgatgca aaaaccgatt tcatacaggt acgtagatct    206820
     cagcgcgacc tgtccgaaac tgaactgact tcacagacga tgcgaaagaa ctagaaccgt    206880
     gctttccagc caatatacac cagcgcaaaa accatggaac actttcccgt gtcttcttct    206940
     gtagtcttga ccttcagaac ctgtgagtca tctctccgat gtacgagcta ataatggact    207000
     agagacagtt gacagcgcaa cagcgcacca gagtgcgtcc gaaccagcat cccgtcagcg    207060
     ctccgcgcga agccacgggt tacacaccat ttctggtcct gccgcttcaa atcatgcagc    207120
     gtgtcctatg tgtagcattg caattcaagg ccgcgggccc acaacaggat gcataagctc    207180
     gagacgttcg ttgtctacgg tagggtgagt ggaatatcgc gcgttttgct gcgctgggtt    207240
     tgattgcttg tgccaagcct gcgcctcaaa acacgaacac cactgtctcc atgcctttgt    207300
     aaaagcagct gataaccaac cgtgaaaact cttgtggcga ggaattattc cttgctgagt    207360
     cagataaccc aagggcacta cgacgcgctc catcgcgtct ttcgccttgc acctcaccgc    207420
     cttcgcaccc tcaacaactg agtgcctctc cacgaagcag tctcccaata cgactgtaca    207480
     atttcttgtc acagggggcc tcgtcgcgcg cctttgccgt cttgtggacg tgccggcgca    207540
     tccagcgcgg cttctcgaag cgacagcgga gagtgcgatg aacctggata caacatggta    207600
     tgattggtga ctgcgttgcc gaagagaatc tgaagtgatc tagttgttaa gctggtatgc    207660
     tcacaattcc cattaattat cggtctcaag catacactcg gcggattttt aatgaacaac    207720
     ataaagcaca atagcgtcca gctggatcaa tactgctgac tcggattcca caacaggaac    207780
     acaccctcag attcccacca ctcgaatgcg aagcaagcca acgtcttgtc tgctcgagct    207840
     cccttatacc agtgcgatca atgctctgtc cctcccacta tgaatacagt tggcatcgat    207900
     catgagtcac cgtacgcttc atatagtgtg tttcggttct ttctcccagc cgtttctgtg    207960
     catcagatca tgcgttggtg tgcctatctg acgcaagacc caaacttcaa tgaacgcata    208020
     gcatgtctgt ctctaggcat tgaacaccca caggggatag cctacttgcg gcttggatac    208080
     ctgacgtcca gtgggtgacc atcgttgtcc tcggatggcg tctacagtct ttcgagcatg    208140
     ggactttgaa agacgccgag aaattctggt gtttccgtct gcttgatagc ggacgagccg    208200
     tactttcgca gacggccagg ttgttagtta aagttcgcgt gaaggagaag gcgaggcgaa    208260
     ggtcccgtct ttcctagccg aataaactaa caaataacca tctcagcttc aaagcaagtg    208320
     aataagaccg aggacagccg aaccaaaggt agggcccatg acccaagaaa caccgtctga    208380
     tacagtccca cctgacccct ctcccctcta cacgttgctc agcttgtcga cttatacgaa    208440
     ccattcggac atacacggac ctgcatgcta ttagaagtgt ctgtatgctt cctgttggac    208500
     agaacgttga tcaatttggc tccgaagcct tctttttccc tctccaagcc caagcactat    208560
     gtccaaagca gttgaaagtc actacagctc caggtcagtc aagctatcgt gtatcctttg    208620
     tccacggtct tgccagcata tcaccggctt ctctagctcc cgagttcact atcctttgag    208680
     cattgatgat gtttccgcaa acccatcgcg tccggacggt atctggcata tcactgtccg    208740
     agcaacttac cgtgaaggtg ggtttgatgt ctgtaacagc accactagag ccattgggtt    208800
     gtaggaccta ttggactctc ccgtatagcc tgtactttat tttctacccc tagtaagccc    208860
     ttatgccata tttgcttgag gaggaatttc agcggatgtt cagggccgca tgtggattag    208920
     agcacccctg tgcgaatacc atccggtcct gagcggtgat cgtggagagt gtctttacag    208980
     tatcagttct ggttccaaat gtctagctgg aaaccaatcg gacttcaatc atgctatatc    209040
     agcagcggag catgccgtat tgtatgactc gggaataggc accacagaaa gaaatgactg    209100
     tttcttaatc gctttagtgg acttttacga gagattgggt gggctatgaa tcggaagtac    209160
     tgacggggaa ttatttacaa atttgcgacg gctcctaccc gtagaagaag cgaagcagat    209220
     gctcccaatg gtatgttgac ctcgagagaa agcaactctt actctagaat gtaggcattt    209280
     tattataagg tacgttcgag cgacacgcaa tatccatgtg gagaaacagg tctaactaca    209340
     caagcaacaa agcctattgc ataatcatct cgacatgggc ccacggttct tatcttctag    209400
     acacatcaca tggctctaca cttcgtagtt ctgatcctga gcgtacaata tattgcgtga    209460
     ttatagctga ccttcttttg aactgaatta tcttagttgg gtaggagact gcacatcagg    209520
     gagcgacgaa agagatcaaa atcgccctgc ggagtcaaaa aaatgcaatt gaaatttcta    209580
     tagtgtgggt gacatggcaa gaaaccgcgc tgcctacgtg agacggtgac aaccactccc    209640
     ttcaccgtcc gaccattcac cgcatcaaca tcaaagataa catcaacgtc aacacatcaa    209700
     cacatcaaca catcaacaca tcaacacatc aacacatcaa cacatcaaca catcaacaca    209760
     tcaacacatc aacacatcaa cacatcaaca catcaacaca tcaacacatc aacacatcaa    209820
     cacagacgca ggtaggattc tgcgatgcag atctcagcga cgacccacag gacagtagat    209880
     cagggaggtt ctatttgtga cgagaaaatg gaaacaattg caaaggtcca gacacgatcc    209940
     acaagcccaa agttggccgc tgtcagggtc cgatggaacg ggggattgtt gcctaggagg    210000
     tactgctggg gcaggtgagt atttggaata acacgcagac tttggcggca gaatggttgg    210060
     ctacaacccg atccgtggtt gtgttcactt ggtcgcagtg aagagaaagt aagttcccct    210120
     gtcaagtggc aagctgaact ttgcctatct ggtctgtaga acgttctaga agctacgtat    210180
     cttcttctgc accaagcttt tccgtgatga ttatactggt tatactctct tcgagcccga    210240
     cagttcctct ccatatgccc aattctatcg ccagtctgat aactctagca gatagcttgt    210300
     agagattatg ccaattatgg acaaaccaca tgagcttaaa taaaatgccc ccgttttact    210360
     aaaaccgatt ggcccccgga cgagatttca atgtggaccg gccctcctac ggccctaaac    210420
     tttatttcaa tcaatctgca catcttgatc ataatgctga atttgaagaa aaactcaaat    210480
     aaaatattgg ccttaccgca gtaaatttat cctacatacc agccgacgga gattgtgggt    210540
     gattctgctc tagttctctt ttcttttggg ctgcaaggct taatcacgag cagcccagaa    210600
     agaagatggg gaaagtccca gacttgaatt cttgattaca accgtattct ctcaccgagc    210660
     gagaatttcc atggttcacc gaaacaagcc ctcgaaatga tttgcggttc cgctactgat    210720
     cggcagtccc gctcgtggtt ccgcagtctg tgtcaaatct aatttccttg tgacttgggc    210780
     gtgggtcgaa agcagatctg acgcttcgct gcatagatca ctctgttttc gaccaccgat    210840
     tcaatcaaac cccaccaggc atattttatt gagctaacaa gatttcagtg ccagagcccc    210900
     ttccaaccct gtcctatctc tctatgggaa cgcgcatagt aacgtgaatc cttatgcatt    210960
     gtccgcagta ttttgccggc cacatgggcc atgcccctgg tttagaataa caaggatgaa    211020
     actctgtagg cgggcctatt acgagacaac acaaccgtgc tagaatgttc gcctttgacc    211080
     ttggaatttc ctcactgttg ttgtaattcc acataagagt gattgctcct ccctatacga    211140
     aatccatgga gtgatacaca ataatcccga tatccctcat gccgaggatt cattgttgaa    211200
     taatcacatc ctttatggca acaccataca ccaggactat ttcatcgaaa tagttggccg    211260
     ctattccttc gacatagcaa tgtagcgctc cagccgatga catgctgcta gtgtggacgt    211320
     tctgttcggc gatatctcaa tttcctggcg gcacagacac gatgtacata gtctcacatc    211380
     caggacggcg atcgtgttct ttgcggcagg tacggaagcg atgctggcgt cacgcagcct    211440
     gtggaaaaag atcagcgtct aatataggaa gaataaaagt atttcatacg tatttccgag    211500
     ggtgccgttt gagctggttt atcgctgtcg ccaggctggc aagggtcggc cgctagaatt    211560
     gtttgaaacc atttgtcaat gttcctttgg gcagacgtat tgtctggcag agtcgaccgt    211620
     gcaccgctat cgaccagcga gagccgcacg tcgcctgggc gcttttgttt gcctgaacgt    211680
     ccggggacct tggcgccagt gcggcgctgc ttccgcagaa tatggtactc tttccctcgt    211740
     aaagactcaa cgcttcgatc cacctgatat tcttcataat atgcgtcgga gagggctttc    211800
     cacaacaggc cccgatggga atccaaccaa gagagaaggt tttttatctt cccattctgg    211860
     ccagccacat gcgctacgtg gggacatggt gatgctcggg taagtcacaa aagtgggaag    211920
     aacggttgaa taaaacagca gaaagtgaat tcgaagagga agggttgttg agtttaaaag    211980
     atcatagtgt tgcgcataaa tatggcgatt gcgtttatga gccatggctc agcttggtga    212040
     actggtacca gactctcacg actcgcccca gctcaagttt ctgaagtcca gaagccttca    212100
     acttttgatg tactgtattt cgttgagaat caatcaacaa cgttgaacag ccaccatgca    212160
     cctgttgata atatcacatg gtttcaccag ttcgttgaaa catgtcagac tcttagtgag    212220
     ccatgcagta atcgaataga tatctacgtg cagaatcaga atgcatgggt gaaaaatgcg    212280
     tgcgcttgca attcccgtta tcgtgagcaa gcacaaaact taattctagt ctcgcgatac    212340
     aacttgctat aaagccggag tgctttctcc tatcacactc aaccagaagt gggaactctc    212400
     ttcacctcag cgtaactaag acgcagacat gggtggaatt cgaaaagcct cgcgccctct    212460
     tcgacgacca gactttcgga gcagattgca acgtgcattg tcattgtcgt ccttagagtc    212520
     tgaggatacc ggcagtgtgt ccagcagcgc tacaggtgat acaacaaagg acgagtcacc    212580
     tcaggaggaa aacaactccg gcgaccagga aaatagtgac gcagctgatg agagtgagca    212640
     agaagctaca ctacagcgga gaactgtgtt tggacatgaa acggatttgg aaatacgtgg    212700
     gcaaactcag ctatccggag acagcaatac ggttgctctt gaatgcctga cggagtaagt    212760
     acaatcccac acggacgtaa tttagaattg ggaattggcc tgctaacaat atccagacta    212820
     gataaccgaa tggggtgagc tgctgtcgat actgagtgag aatgtaaagt actaaccgtc    212880
     tccgcaggtc tattgagcgc tcatcgcatg accaagccac ctggaatgaa accattcgca    212940
     acgatctggt cgacatcttg ggccgattgg caatcgtcga gactgaggta ctgaaggtga    213000
     ccggacaggg tacaaacaaa tctacagagt gccagaagac tgggcgatcc ctgcgtcggc    213060
     agcagtgatg cgacccaaac tgtgttttga tatccgacca tatttaccag agcaaggaaa    213120
     taattagtgt tggtcttgag ttgtggataa gattgtttca ccgactgaaa gtattactat    213180
     ggacactccc attatggacg ctgagttgga gggtcactgg aaaaggtctg attgacccaa    213240
     tgccgagctg ctgccagagc gagtcatgta tagttttgtc gtcgtactat ggtcttcgaa    213300
     ttttattaat gcttgcctag gttgtgcaca ccaaagctat ctcgcccgag ccgaggggct    213360
     agtcgcgagc cactatatgt aaaagagtac tttaagcctt tcattagttc caccattgca    213420
     gatggtttgt actgtctagt ccagtatgct tgtgcacggt ccgtacaact ggcgactttc    213480
     cccaaaggct aaagccacag tagtacataa gaattatact ccatgtaaag atgattgcag    213540
     attggttgtg acgattgagg tgcgatcctt cgcgttgata ctagtagagt agtccaatgt    213600
     gcctagttgt tgagcaattg ctatttgtga ttgagttaga tcaggacata ctacggcaag    213660
     ctttggattg aggaacgaga agagataaca actgtagtgc gcaagagaag cgggggtttc    213720
     tccattagac ccatagccac aaggcctaga attgtcctga tcggactatc aagatgcatt    213780
     ccctttccat ggactacaat aaatatcaac tccacagacc agcgtgccaa ggtctttccc    213840
     atttctgaag cgtatctaag cggtgtgata ctgaatccac cacgactgcg tctccacaag    213900
     tatcagtcca acctactcat tacatttctt atttgtataa aaaacaacca aggagtagag    213960
     agtggtgaac ccgccgttaa cctgcgccga acaatgtatc gagacgcctg tgcttacttg    214020
     tactggtcgt tcttggacca aggcgcccag cgatattctt cggagcaaga aattggcaat    214080
     acacatacat cgtaatcact acccttagaa tggtttggtg ataatgttgc aggaagcctg    214140
     ttcatgagct atctgcgcgt tgactccatt aaaaaggcaa ttctatccac agggaattaa    214200
     ggcccagcaa gtccaacgca gatattcgtt caaacgagag atccgaattg gttgctcgca    214260
     tacggttcct gctgactagg aagcgggaca ttcgattcag agatgctgag gtgggcatcg    214320
     tggccctgag taaccgggcc gctttgctcg gcccagtccg cgtggatcac tccggagccc    214380
     ggtaaatagg atgccagtcg tctgttctgg agggtatcga tcgtgttcca aaatcgggtg    214440
     gtcgtcgata ccatgtcccc gtgtgcctga tccagaacca gctgaatatc attccatggc    214500
     acctgatcct gcagagcggc atttgtggac tctaactgct gctgcaactc acagatctcg    214560
     tgcctgaccc gttaactgtc agctaatgcc acatctcttg ctgcaataac cagctgcaat    214620
     ttcgaagttt catcggcttt ctcggcctca agttgttcca gcagctggca atgcttgtct    214680
     ctctcctctt ctctctcctc ctgcgctttt tggatctctt cctcaacgat gctcattacc    214740
     tggagacatt ttctatgggt cgctttatcc tgttccggcc taggcgtttg tttcttcatg    214800
     atggaggatg cctagcatag tcagttggga gtacgtcaag gtagtcacca gggcaatgtt    214860
     ggccaaggca aatccagaaa atattgtgga aggtagagat tgggtaccgt atgcttgtgc    214920
     aacccagtcg ccggtttgag agggttccga tcatctttcg atctagaccg agtagatcga    214980
     aggggataac aggaaggcgc agcacgcagc tgtatttcac tacagcggtc tgcctgttcc    215040
     cggaaagcct tgtgattctt tgccatgcta ggtgtgttcg atcgtgagat gaacaatagc    215100
     gcaacgagac gtggaaggtt gaaagtaata caagaagtga gtttcgagaa gctgaattat    215160
     atagtacgag gagacccgag gagacccaag cgcaggactt gaatccgaat gaaaccgctc    215220
     ttgctcctgc ccaggacgta tgccaaacaa gggtcataat cctaagaaaa ctgagcactg    215280
     ggcattagtg cgaacgcaca aaacacctac cgctcgatta tggagggtgc gagccacagg    215340
     tccgcacaaa tatgtagttg ttgcatacaa ccctgtttca tgatagcaag gaccaatcgg    215400
     ccacatcccg cccaaagttt agtgtttaga caacaatgtc atctttcaaa tgctttgtga    215460
     aatttgccga ctcccacgac tctgcattgg tcggccctaa aaaatagcgg ccttgttttt    215520
     ccgaattaag agttctcact ttcctgtccg catacgtctg gattccccag caagccgtta    215580
     cttgagtcac ggggaaaggc atttcttgcg gccaagactc agtagtaagg gtatcaatct    215640
     agtgtccacc atagcataga gtcgggtata agttttattg agacctcatc aagtaaactg    215700
     ggctactaaa gaaaacacag gaaaaagtaa cctcaatttc tgttcaaata catcctcaat    215760
     cattaagttt tggtcggcaa acgctggaat taatttggtt ggggcgtctt cacgctgcca    215820
     aagatttctg ccttccaagg tgccggcgga accgatagta acttaatgga gggtggaaag    215880
     ctgatgcgac tgagcagact gtcgggttcg ctaacaacat tcccaaagac ccagcaaata    215940
     ttggaatata tatattgagc aagattgggt cgactccatg tcttttgtgc tatctatctg    216000
     ttaaaattgc aatgactcca acagctcgcc ggccccgccg ccaaagacta gccagcgccc    216060
     acgatctgac gccattactg tgtgacccct caaatattct gccatcaaag atgatcactc    216120
     gccatgccgg tcgtaacatt cgcactgact catcgagccc acctttgcag cgagccaaga    216180
     aggtccttga aatgaggatt catcatcgat ttcatggctc gcacgttacg ttcctagaag    216240
     gacaacctgg cagaccccaa aggaagggtg ccaaagaaac cccgcgccgg aagggagcga    216300
     tttcggagcg agaggcaatt cgattggatt ggatgcggcg acttcgtccc aagccccata    216360
     gacgttgtta ggtcggacaa ggatagggca gacatgaaga cccagagggc agcatgttgc    216420
     aatctctagt ttcgttccta tatcgttgaa tggatgaaaa taacttgcca gaaaatgaga    216480
     gtgagaatgc agtgcgtgat gagttagccc gtaaacatgg actctatgta gcggattgct    216540
     cagctaggca tcctatcgat tggtatacgc aaaattgcca gtatgcaaga ggatattctc    216600
     tacgctttta tgatgcctgt tgtatacaat tgcatataca agtgcttact gtaattggga    216660
     cgcatagaac ggccagaaga agtgtactgg gatttaatgc tgcttgcttg catgataggt    216720
     gtgccattat ccgtgccatt ctcgaaattc gcaaaggtct ctcaaaatac atattcttca    216780
     aagcctgtat caccaagttg ttctgagaag agatcatgct actctacatg cactgaagca    216840
     aggagagcgc agtttacggt gtagacagag ttcatggggc gtcaagtttt atttttctat    216900
     acctaattta ggcttgaaaa cgattcgttg cgtgattctt gtgaacattt tatcttttag    216960
     agacagcacg attaacaaac tcctgttttc aatggccttg tctgagccac ccgtccacat    217020
     accacatgtt agttggagat aaccaagaac ccacctattt ggctcacggg attgactgca    217080
     aggacgacgc ccagatggcg atgatgacca gttcaacctg tttagtgtca gcattgttgg    217140
     tataacggta taacgtggga atccgcgatt acctctaatg caatcatcca cgatctctcc    217200
     aacgtaccaa tgacggcaat cacaagcaaa agaagtgcca ttgcagagag atgacacgag    217260
     atacaccgca acttagctcg accagcagtt gactgttgaa ataaccacca ataccatgca    217320
     actacacaaa ggtaatccgc taagagaata tagaggctac ccagataagc agattttaaa    217380
     aggaaggttc caacgaggga gactgctatt ttcgccaaag ttgaagccac agagaaagaa    217440
     gggcatatga aacgcagtaa tcgaggtgtg agtgggtttt cgcgctgctg gaagattatg    217500
     cgaatgtact gcagcattgt tagctcagaa cgaagacact gtatgtgacc gagttcggtg    217560
     tgctgtcaac ttaccgcttg tagtggtggg aatattggtg taatccaaaa gagtacttga    217620
     ctccatgctg gaaacctgtt gctccagaac aacccagtaa ggatagcaaa ggaactacaa    217680
     gacaaggcac acagcgctaa atcgacttta taccaccgcc agcgtggttg gatgcaatac    217740
     aaaagaaata gtcttccaaa gttgagaagt agaagaatag tcaccaagac ggatctgatg    217800
     atgttttgtg aaaccacaac catacctgac tgccagctaa tgttcttgtt tggacgaggc    217860
     cttgagattt atataccgaa acagagacat attggccagg taatagtgga taaattccca    217920
     ggatgtcttc atttgactct aggattttct tatactgagt ttcctgccta ttaaaagcag    217980
     ctgccctcaa tcttatggca ctgaaggtta actgaggatt ctcagttgag gcttcggggc    218040
     aacacttttg ctcttttgct gcgcagaccc gagaagagat accacattta aagcttgcag    218100
     tatagtttct gatttaactt gcgacatgta agaccacatt tacaagggcc aatcacagtt    218160
     gcagtatcct gctttcacat agacatcata tgcagaggtg gtgcatacat ttataaacgc    218220
     ctaactcaat ttctggagag cactgcgatt ctctcaggac tcagtcttcg gacccgtaga    218280
     aaaagtaaag tgtgtgctcg ctacaatatg cctggaagtc acacaatgtt ttgataaaac    218340
     agcattcacc tttaaaatgg ttggaattag ccatagagta cacggtgtct tgaatgagtg    218400
     catcccaagg gcagttttca tgcaccgcgg attctccgtg tcagtttcag cagcccatgg    218460
     ttgtctgccc tggacggact ctcattagct tatcgtgatt actccttagg ccaaaaccgt    218520
     aactaaccct tgctcaaagc ccatgatttg ataatgtttt accatcggca aaattcaata    218580
     cgtatctcct ttccaaaggg tgctgggatc agcaaatgtg gagaccgggg ttacaatatc    218640
     cgttcaccgt catgatagta tcttgggatt cgtcggtact ctatgtaacg gagacaaatg    218700
     gatagctaca tcactaaacc atcaaagtaa gcgaaatatg ctctattcat gggttatcgc    218760
     ttataatctt cactggcggt ctgaagtgcg tatatattgt gttggccgat gagtagttgt    218820
     tccaacagcg tgaagttacc aaatcggcaa tgatacatag attgtgtttc ccttttctca    218880
     ctcgtgtcag aaggttccag acaacaggtt atacagggta tcgttaattg gttcctgtaa    218940
     tctacagcat gcgatgtcca aataaacgtc gatagatgtg acagaaatac ttctgctatt    219000
     tcaaagtcaa tccgctcaga atgtgggact tttcaaattg attacgtttc tccttgctcc    219060
     tctaaaaaat acacgcagac tttcccaact aagaaacaaa agttaatgac atatataaga    219120
     gataataatg aaatggaaaa cagcatctgg atcaccgcga cgcagacatt tcatatggtg    219180
     aataagtcac gcacttgaat gttaacggct catctagaca gtacaccggg aataaaccga    219240
     acgatggaca acaggacatg acgtttcatg cgtgcgagcc tttgtagtcc actattgcca    219300
     taattccaca cactcgatat caagacatgt aaggaattgc tacctgcaac accgctttgg    219360
     aatactctac gaggctgtat gtcaagatca agtacatgcc gtggagactg ggctgccaga    219420
     actggaccat tccaattctc tcaagagggc gcaaagcgta cagagcataa ccgcagaggt    219480
     tgagaagcac tagtctgccg aatgcagtgg ccagtggata gggagcgtgg agcggctcgg    219540
     ccaatgcgtg aatggacggt accaaggcca acaggaccac tgaggcaaat tgaagagaca    219600
     attgggcgga aaatgccccc atgtccatgt ccttgagata gccgtccgag aggcttccaa    219660
     ccgcgatcat tgtgaaagcc gatgcacacc caagttgtag caatggttgg gctgggaaga    219720
     gaaaagcgat cgtgggaaga gctgcggtcc agaccaggaa taaaccacca aaccacacgg    219780
     aatcttgctc tttcgtcatt ttctccttct ggaatgcact gaagcaattc tgaaagacaa    219840
     cacacaaata ccatatggcg cttcctccac caaacgccat cactgctaga gcgtatggga    219900
     ttgaccgttg agatgagggg aaatggaaga tcaagaacat cagtagataa atgacaaagt    219960
     aggagaatcc aagcgcgcct gtgatggcac cgatggcgca gctgcgcagg ttttggtaat    220020
     cgagagtgtc cattgtgtaa agttggagta agcaccggcc ctcttgaggc agcatccctc    220080
     gggcgagcat ttggctttat agacgagagt ggagctcagt ctttactcgt tgaccgtggg    220140
     tcaggtattg caaaaacata agtgttggaa taatgatggg tacggtgttg atcaccagaa    220200
     cggtgaggaa ccatcatatc tgtaatgacc acccacctca acggccggcg cctcagaagt    220260
     gaccacgttt ctgttgagtt gccagaaact cctttttgcc tcatcgatat tcaatctaac    220320
     cgaccgaccg acagacctcc ctgactatgt aattggtgtc tcattatgca aatgcaggac    220380
     ctgagagtcg tttgtgattc ttcctctctt ccatgatagc accatggaag atattgtacc    220440
     gattgtacgc cagatcggtc aacaacaagc tcataatgct tattatcgcg attgctattc    220500
     ccccttcaag ctactccaag agctcaccga actacaaaga ctttacaaat ccggcaccga    220560
     gcgctcgacc aattctgtcc atcaacttct ccgaaatttt cagaacacaa tctgtaatct    220620
     ggttgaaaga gcatgcgaag cccaagcgga atgcgagaag ttctgctcag tgaatgaatc    220680
     acactcagcg cgcgttgtct tcgagcccat caggagaatg tacaccaacc cacaagcctc    220740
     attgcagggt acaagatgat ggtggaacta ctagcctggc atcgtcgcct gggaagacgg    220800
     acgcgcacga ctggtaactc tactatggtg atattttcaa aggcgggatt tctgtaaatt    220860
     ctatagagcc gcgtgaaaat cataatgtac tttgtgtacc acagtatttc tctccaaaag    220920
     ctcatacacc atgtaggagc ccaccaacac aaagctctca tgaatcagac acagctatca    220980
     agaagttccg attaccacag aatgtgcacc ataaaggcga gcaatgttta gccccaccat    221040
     ctgccaccgt ccttanatat catttcccac actcccaggc cgaatgacca tctacgggct    221100
     tggcaattag atgcaacagc agaaaagatg gaccaaccat atggttgaac caccaataga    221160
     aaagaannct gccaaccatg ctgtggtaaa catcttagct ccaagggtaa cttcaacgcc    221220
     gtaaggctgc agggtgttct tgaccttgga agcaaaaacc ccatacatca ccgtgaccgc    221280
     aattgtggca gtcgtaatca gcatcgagga aagcttaatt tatcagcatg tctcttcaat    221340
     atttgtccaa gtatcacata ccgtgtaaaa tatggcaagt gatctgctgc cttttgaaaa    221400
     gaaaactttg cgacaagcca aaactccgga taatgtggtt accacaaacc cagcaatata    221460
     caaacagacc acactctggg aaaaccgtcg gtagccggaa accaagctta ggtcaatatc    221520
     tggaagtatg ttgctgagat ttatggatgt ggaatcaagc acggcggata ggtcaaaagt    221580
     aaaagaggtg ctggggtcgg aacaaaccat ctccgagcca tccttggctt tacagtagct    221640
     ccagaggcca actaaatagt attgaggcag atgtgacttg aattcgtgta cctgggcttc    221700
     gaccatgctg ctggcagctg acgttgcctc atggattgct tcatttgcac tggtatggct    221760
     gctagatgcc acgcctccga cggcatttct tcccccgttc tcaatacgcg cagtatcaac    221820
     attgaatggg gtcccgaatt tgcaaatcac gcagctttgg aaattctttc aggtctacct    221880
     gacgattgct tagcattgat tagcatggaa gtttttcggg cgtatcttac ttttagaaaa    221940
     tgtagaccct tcggcgagga agacgacgaa catccgacaa agacaagaga tagacagact    222000
     agaacggcga cggtaaatga caatgctgta gttgaaacta gcgaatccaa tctgctcttg    222060
     gtggaaagct tcatggcttc agaagggaga agataaagga gtgtctcttg accgaataat    222120
     agactttgag atcgagggaa caattgagaa ccatgctgta tcgcaattca gggaagcata    222180
     tatataaact ttccagatat ggtcaactta acccgtgtgg gcagtgttct gcaaatttaa    222240
     ttgaggccgg cgcaattttc cgcctcattc tatgggcagt agtagataaa tttgtcaggt    222300
     aaactacagt gaatggggat ccataataca taggtgttgt gagggcaggc agataattga    222360
     cagcattaac cgccggaata tgagggcatg caattacaag tgatcaggct ggcgagttag    222420
     atcttcggcc cacaattatt ctcaaatagg ttcaataatt aaggtggtat aaatactact    222480
     ccacggagtg accctcgaca tctaagttgt ctttctcgtt attccataca cctcctcacc    222540
     tctaaatcac aggtgacttg tactagcccc cgtcatgcca ttttcaaggc agtcagaagt    222600
     tgaacattgg gagcggaaat tatatgacta tagagaaagt catttcgagc tatctgccag    222660
     agtgcacatc tctcacctcg tcttcgagag tgggttcaga agacggatgg acggccggca    222720
     gaatatccgt cgattgacac aaatgatgaa gatgcaaggc tgtcaacgct tgatgaggga    222780
     caaccacgtg ccggtgatag tccccagggc tcattggcaa gatcgcgtgc ggccccgatc    222840
     tggcggtgga atcattccta gcttggatat ggagctggac tataggttgt gcgcatacga    222900
     ccacgagaac ctcataacgg ctgcaaggga tttccttggc cacgacgatc agtggtggat    222960
     cgtagatgtc tatctgacag ataacgagga aggtgcgttt gctcagtttc agctctcaga    223020
     gatcctcgtt gataagttta tagtgtcacc aggcgaccac agaaatgaag cggagtctgt    223080
     tcgccacaaa ttcatccaat cgctgaagga gcggtatcca aacgacaatc gtccacctga    223140
     tggactgatc tacgagcgga ttaaccggta cgaaggctag ctcgatacgc ccagggatcc    223200
     gctcgctgcg aataactggt gggctgtact ggaggccctc gcgggaagca agaaaggaat    223260
     gtatttgaag caatttttca aacacgagac cttacaccaa aagctaaatt ctttgctcgt    223320
     cattccgggt ctctggggag ggatgcggat tgggctactt cataaactga cagccatgca    223380
     ttgcgacgag gtaagtttac tctgaaccac aaagccagtt ccatctcagc taacttgatt    223440
     gcaaatctag ccagtagcat gctactggga attgatcttc accacttttt cgagactggt    223500
     tggaggaagg gaagagcttt tattgctgat tgacggagtt acggtcgagc tgcttcaatc    223560
     tcgcgtccct aaaatctccc gtaaagattt gcaatccttg caggtcgagt tggaggaggg    223620
     ccggcttttc ccgaacttct cggaagaggc tcggcaggac atatgggcgc gtttgaaaga    223680
     gatcgattat ccaattccaa ccttgaaaac atttttcaaa gatcggctct atcttgaggt    223740
     ggctcaaagt gtcatgaaga gactgttcgt ccagccgcga ggggataaga ttaccattga    223800
     ccagggtgtg tacgggaagt atgacactcc ggttcccgtc tcgatggcgc tgagacagga    223860
     atggttagga tccgacctgc tcgaattttg gcgcttcagc ttccagtatg gatttgaaat    223920
     gaccgatcac caacgcctta aatggccgac agacgctgat cccgaggata tgcttgatcg    223980
     gcgaagctcc ggatcgtcct ttcttcccaa gcaggaaata tggcgccatt tctttacact    224040
     ggtgagagcg agaggtttcc aagcacccgt cacagacgac acatcatttg caacagggga    224100
     gctaccttcc cctagagtgt gcgaatttcc agaagactta gccgaagaaa tagaagttgc    224160
     caaaagatgt gggaagccgt actcgaacac tgtcgaggca gatcgattcg ctttgtccgc    224220
     agagacgctg cggcaaagtc aagcctcggt tcgagtgacg gcggggtttc tccgacagtc    224280
     tgtttttaag gcgttctttg gctatctgtg gaatagcaat aatcaaatgg ccggtggtga    224340
     tcctcctgac gacaacattg aagttcacca tcgcggcgaa aggccgacta ccgcaaatgt    224400
     tggtcgggcc atgatggcca cagacggcat ggatgtggat cctgggagcc tcaggccaaa    224460
     ccctctcgtc acctcagcag cgcggacgca taatgccgcg gctactgctt caccagctga    224520
     catactgccg ccgttcggtg tcatgaccat cacggttgga ggaactacac gaatattaga    224580
     cctaccaatc cacgactcat ttatgaaaga cttttcgact ggtctattca acaacaactt    224640
     caacgtccag accgatgaga gggaaaagcg atccatttcc ccatatacgt gctactctca    224700
     ttatctgcac aatccgtcgt cggtgctaca cgccgaattc agacaaaatg agcatactac    224760
     ctacgctatt gcaccctcgc aaattggctc tgggagcaag agaaggatgc ttgatgaaga    224820
     cgagcagatg gctagagcgg aaatatggtt acaggagcaa attgcgtggc tttcggatcc    224880
     gcgtaacggc gaggaagacc tttgacggga aaggaggtat cggattcggg ttttaccaag    224940
     gccttgaaga ggctcacggt atagaggagg cctggtctgg tagagatggt atgagtgggg    225000
     catgttaaaa cttcatatgc tagggaccta tcatatctcg gagcatggtc atctaaacgg    225060
     caacgtttta gcttgaagcg agcaagccta tggtatctat cttatatagt gcttaggaat    225120
     agatgataat gcacttcttg atttattggg aagcgttgtg gttcgattaa atagaattag    225180
     acatatgctt ggtgtccggc actgatcgtt atttatattt tacagcctga cacattatat    225240
     agtaagttcc atagcccgag gaatctcaat ggcttcaact attctctgat ttatatactc    225300
     ttcttccatt caacacatag cgtcatactt gtagttcact ctctggccac catcaaaggt    225360
     tctacaccac atggcgtcgc ttcaagttta acaagtgagg tgctgcctct tttatctcaa    225420
     tggactatgg tacactccgc cgactcaact acctttgctg acccagaggc gcaatgacaa    225480
     agaccaccct cacgatggtc cgcctcccta aatatataat tagacaacac aacttgaatt    225540
     ccatatcaaa gagtggctta cttgatgagg caggtattca ggtcgagttc cccagaaccc    225600
     ttcggcgacg gtattgtggt ggggccatgt gtctcgctag gtgcgcttgg ggatgccgag    225660
     atgctcgcaa agcttgatat attcgggagc tcgcagctag agctcgcagt atgggtagca    225720
     gacccggtac tctcggtatt ggtgcttgtc tgttgttgag tgctttcggg tctcgtagtc    225780
     tctttattca gtggcggcga ttggcatgaa caattgccct gctgttgcga gggaacctca    225840
     taaccagctg ccctttctgc atgttgcctc accgaagcca tcaggggaag ttgaccgccc    225900
     agggagactg caataccacg ataatcgatg gaagcaccat caacacctgt aaagattagc    225960
     agtcaggtat aatgcgaggg tagtatgata cctacatcta ctgagtgcgc tttccatctc    226020
     agcctcgcag tcaggcgaca aggaaactga ttgcgtgtgt ccagaagttg aaagcgtggc    226080
     attcaagctt cctcccatag cttggtgcca tgagctgact gtattacatg tagattgaat    226140
     gaggggccga agatcaaggg cttgaacttg accgaggata gcgatgactg taagcagaga    226200
     cctgaacatg atcaaacaac tttggtatcc aaagacccgg ctttggcggg tggtgctgcg    226260
     aagcgctttt atatcatcaa ggttcgatga gcatatttct gaggcaccaa tttatctagg    226320
     aggcgtggca atcctatgaa agtaaaagaa aacgagaata acgacgggtg gtgcatcatt    226380
     atgttggcat cactggcatc aaagtaatgc cgttgacatt gaaaattgat gtcagcggga    226440
     gaatcaactt ttgaatttgg gacagcacat ttgtgcccgt atagctcaat ttaaggttcc    226500
     ctgcgtgtga agctataact ttagaaatat acnnnnnnnn nnnnnnnnnn nnnnnnnnnn    226560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    226620
     nnnnnnnnnn nnattcgctc tgcattatgc gggtttcata tactgacttt cgataggtcg    226680
     caaggcccca tgatgacccg atccacacag caacatccac ccatccagtg cgatccccag    226740
     aaagcgcatc cgcgaccgtg acccgctgac gtattttcta gtatcattct tcgccaacat    226800
     tcccactgcc gaaactaccg tacgaaatga tcatagaggt cggtccctat cattgattgt    226860
     cttgcaagta tctaatgntc gcaacagcaa actccggctt gtgtatattc gcacggaatt    226920
     gcttacatgg acgctacgac ggagaacatt gaccacttga gcaaagtcag cgaaacctcg    226980
     tgcaacgttg atgctggaaa ttgtcatcgt ctgtcatatg ccaacctatc tggtatattc    227040
     ctttgcaact atgtaagtac tccaaacttc aagccaaata gggctccgtg ctgacggcac    227100
     taagagcctc gagcgcatct caacaaactg tggaagcctt gtgcccctgg cgacaaaggt    227160
     tcaacaaaca tgccnggtag acaactttta tacgtttgga ttaatcggcg gctcttctca    227220
     aaacgcgagt gtctcgattg actttcactt ggtagttgcg ggcgaaacca tggggtatcc    227280
     tatagagtag ttcagacctc acgaccttgc cactgagtcg gattggtatt cggggtggac    227340
     caattaaggt gctgccggag cgtggcacgg acgtgattca cattttcgta tgtagattct    227400
     tatagaactc tcaaaattag ggagctgttt ttcctatgga cgcggtcgaa atgagtttca    227460
     ccaaattgtt ctctttgatt gcttctccac ctccattttt attgacgata ggcctaatgt    227520
     agctagtgaa tattcattgc ccttttccta ttcgatagta attgatgggc taggccagat    227580
     gtaggccgag gtggtccggc caagacttag gaaaaaacca aagagaataa aatggtgaag    227640
     gaatttcggg cggacctgta aagctcgtgc gttggtaatg ccctttcttc aaagtatcga    227700
     aggctatcgc tactcaagaa gcttataatg attggaatag catgtaccgc gttgcattgt    227760
     caaatcgttg aaaaccagta ccagccttaa ctcaaccatt gtgctcatgc ttactgcatg    227820
     actgatgata taataattcg acagtacttc cgcccaaaat agccaaaaag cgtaaaacaa    227880
     atagtcacgc gcgtaaggaa ggaaatcggt caattaacag agcggtcaac cccggaatat    227940
     tcactctatt tccatcaact ggcccctcac tgcatttctc gagataatgc tgaaccaaca    228000
     aagatccaat caaacatatc cgcctcgggg atagctcatt tttagtcatc tcctgcttgc    228060
     acacaactgc ctttgatgaa ccgtttcgag atgtcagttc ttcgagctct gcttgcaaga    228120
     atgacaagtg cgcacgaaga cgcgaaatcc gttttgaatt tcggtaaaca gcccgactca    228180
     gtggtttcaa tttgggccag cctcgtctct tcagagtttc aattttggtc aggatttgac    228240
     ctgcacccaa tagatttact aatggtaccc gagattgctt ggcagggaat ataatcttat    228300
     aatcatccct ctttcgctga agcgcctgtt tagactgcaa ttgagccaac agatgcgata    228360
     acacggtcgt aggatccagg ctgggacggt gaatagttgg tattgttgcc atcaatgttc    228420
     ccaccgaccg ctccacttca ttctcgacgg cagtgatacg atgagttggg gaggtgttcg    228480
     aaaagagtaa aaccaacagg atcatgcaac tgatacagca ttgatcggag atttggtctc    228540
     gcccatctgg cgacactttt gttcctaaag ctttgccggg attttggcta atcaattgat    228600
     gcccagaagt catgacctgg ccggtaggga tgctgtacgc acccacttgc gccgtgggtg    228660
     tgttgaagct aaagtccaac atgacgtacg gtagctttcc tggacttact gcgcgggact    228720
     agcaatatta aatagagatc aagtattcta taataactgg aacggcgcta cgagtttgcc    228780
     agtacaccat aatgcgaccg cggtcaccgt tgtcggtctt tgaggctagg ccatttgtat    228840
     cgctgtcggc atcaacggga taaggattat gctggcagga agcagaattg gaggcaggag    228900
     acggtgaagc ctcattatga gaatggccat gtccatacca ggtcgactcc gaattagaag    228960
     gcgtagtagc gtacatgttc aaagcacgac tgtgctgatg ttgatttcac cgtgatcatt    229020
     tttaccacct taccacctta ccaccttacc accttaccac cttcaccacc ttcaccacct    229080
     tcaccacctt caccaccttc accaccttca ccaccttcac caccttcacc accttcacca    229140
     ccttcaccac cttcaccacc ttcaccacct tcaccacctt caccactgtt gagtcctgaa    229200
     tgggaaccac tcttaggctt agattgactt ccatctcata tacactgaac ctagaattct    229260
     aacattaaaa tgtgtcccag agtctagttg gagaaatagg tggtcttgaa atggagcatc    229320
     ggcctgatct atcaagatta atcccagata aatattgcga ggtattttat taatgaggtg    229380
     tcaactcaag tatcatttga aaaatgcgag aattcagctg tcctaggtat gactttcgct    229440
     cttttttccg gggaatctac cactcgttgc gaccgaagga gagaggtcga acccacggca    229500
     tgcctcttga gataacggag gataaagcag tgtataataa agaccccgat caaagcaaca    229560
     ctgcctccaa aaacgctgct gagtataagt aatgtgccct gctttgaaag ccttgccgat    229620
     agattactac catagattgc tgtatcatgc cattcatgat ctgaggtttt tgtggctgat    229680
     gttggtccag aaatcgacga attagtttgc gagctagcca ccgttcctgt caacgtcctc    229740
     gacaaggttt ggcttttatc gctatgggcc agagataagt gatgcccagc cgtcccagtg    229800
     atacgaccag cagtgccaga ccattcggtg ccagaagctc cgtcgctttg gaaaaccctg    229860
     ctctgtccgg tttctctgat ctcggaagct tcggtatgta tttggctagt cgaatgatac    229920
     agggactcca cgaaaggtcc cgacgagtcc tcagagtgcg gtgtttccaa actagcccat    229980
     acttgagatg tacgattgaa tgcaaacggc aaaaaggtgg ctcttgtggt cacgttctga    230040
     agcaagtcgg tagtgttatt ctttgaattc tcaatcggaa agagactatg gtcatcagaa    230100
     ccggtgctgg tatatgatcc tcttatggca ccggttatgg aatctttttc ggtaattgct    230160
     ccattgtgct tgggttccgt cgtaggctca tcaccagggg cgctgactgg agaactggag    230220
     tgtaatagca aatcacagta tgatggacga ttcaaggccg acaaagggaa ttgcttcgag    230280
     actggtgtga cgtgaagcct tgacccctcc tcatgtagtg cctggcttgt ctgagaacca    230340
     atagcttgag tgtacgtagg gttctgtgag gtcaacgtcg gctaagtcaa taattgtcag    230400
     cgatgatgtt caaaggcaat atatcgtctc tgaaggctgg gaaagtatga gaaaaatctg    230460
     gaaagaggca tgtatgatac gatacatacg actgctgagc gatagctata ctttccatgg    230520
     caagcttctt tacagactga atatgcattg atcaagcacg gaaagaccag agcgtgtcaa    230580
     taagataagg tggactgttc aatatattgg gtctctggga atcgccgata taattctaag    230640
     tttccagggc taggattgtg gcaatataaa aggcgcatag aatattataa cagttagtta    230700
     tgtctggtgc tggccttgga aaatgccaat tctgcacgtc aatacccagc cgcatatttt    230760
     tattcgctag accgcaatat aagtcgtagc agtaaacatc gttcaaagtt cctgcaaatg    230820
     gtgaccatcg ttgaagtaat agattggacg attaggccat cgcagatgtc cgacataaat    230880
     aagtgcatcc accggccaag gaaaactacc agttccattg cagcaaatta gtggacaatg    230940
     gcgcctcctc taagccgtgt caagcgagag caactccgta agcgtcgcaa caatctacta    231000
     cgacgccaca atgaattttg gcttctgtat gggatgaaaa gctggctcat catggaactg    231060
     cctgatggtc agatctttac ataccactcc catccggaca cccctccgcc ctcaagggaa    231120
     gatatggtaa gacaaaatta atatgagtat tcgatgattt gccgctgatt ggtgaaagaa    231180
     aacacggtcc aagcccacta ttgttcgaac gcctcgcgac tatatttctg cgacctctgc    231240
     tcagtcagtt ggcagagata tcccggtctt ctgcgcccca gttcgtcagg accaaaaatg    231300
     ggaagctctg gcgaatcatt tgaacaataa tcgccgcatg gtctcgtagt aatacaaacc    231360
     gtttcgtgct tagttagttc actttggtgc atagtgggat ccgtggcgca cgtcaagaaa    231420
     taccgatctc aatacggtgg ctaaagcaat ggaacctgtt caatacagaa gccgggtatg    231480
     acatcaggga gaatcgaaac caatgtcacc attttatttc tttgattgtt tctcaaactc    231540
     taagtctagt cacgccaggc ctaatgtagt tagtcgacga tgtactgctc atcgcccttt    231600
     cctattcgac ggcccgaatt ggtctaggcc agaagtagat tggaggcgac gacccaaaga    231660
     ggacagtagg aaggctagtt aggagcggac aagtaaattt cagttggttg taatacttgt    231720
     cttgtttcct acggccatat tgagagcaga tcataattct agtaaacttg agaagttttg    231780
     gtattgagag gctctattcg gtatatgcaa aggcctgacc tacctatggg ctgcgactag    231840
     ctggtgatgg ccaccgattg atattggtct caacttgctt cttattgagc ccgccaacca    231900
     ggggatcaag cgagggataa tggctcatcc tacgacacat tggaataact atcacccttt    231960
     tgtccgttct ccaacgctac ctacgcctaa cctgcgtccg gagatgtcgg tgaagtcgac    232020
     cgtgttttgc gcttggatca agagaaactg gaacatggca taagcactgt aaacggaacg    232080
     cttgaaaagg ggctataata cttactgatt gggtcactag aaaggcgatg gcttcgcctc    232140
     acgctgtgag tgggtagcga gccaggtgtc tgcgttgcag agaattgtca gcggaattct    232200
     tcgtgatatc gtaatatatg ggcagtgtgt accaccggct ctggtgggaa catgattgcc    232260
     tttaatggcc tggaagcctg gtgaattatt agaatgtctc ggactcggac ggccaaagaa    232320
     agagtcatgc caccggaatg gtaaccagta ggacgcccag aatgaagatc cccagtgcga    232380
     tcatctgtat tatttttcag agaagctatt tgcatcgtga aagggaatga gggaaagggt    232440
     tcgctgttat atatgaccca ctacgcagtc tcccaaaaga attgtgcttt ttgcggcata    232500
     agagggctaa cgaccgctgt gtagtcacag cataaaatcg agtagcccgc agcaatatga    232560
     tgttataggc tatttagcaa cacaaggaat tcatgctacc ctctcaaacg gtacctcaac    232620
     ctcagtcaac aagtttctca catttgatac aatgatatat atttagggta gttctgcatc    232680
     tcgcaggctg cagatcgttt cattaatctc ggtcattatt tataaaaccc ctaaagggct    232740
     aaaattcaca acttaatcac ctctatggtc ccgaaagatt tgctacatga gggtatgttt    232800
     gtccccgaat ttgacaaccg gcgtgcttac taattaacta acaggggtga tggaaagcat    232860
     aatctcacta cccggatttt cggctcgcta ctttcccttt tgcgctcaac accagatcct    232920
     gcaagtcaac agcggcaacc cgaaacccat gccttctgct tccttcagcg ttggcttcaa    232980
     tcggagtctc tcgcagccgg atggacttgc ccagagggct tagagttgca caaatttttt    233040
     ggtctcttgg aagtccatca aggaaaagtc aaggacgaat gttttcagtt gacctggagc    233100
     acgttgacag gatggcgtcg cgtgattagt agcattcgcc acgcagctgt gcaccgcatt    233160
     ccacacgatc ggaaaacatt ccttaagatg gttcgcgcgg ccatcaaatt ttcgaaatgc    233220
     atcgctggct tcaaaggctc caaaagactt tgtcgcattc aaaagttcgt gaagacatcg    233280
     gtttcagggt tcgaccagct gagagcccag ctaaaacaca atgcccgcct acaaatttct    233340
     ttgggtgaag cccaccgcga tcatttagcc cggcggttgg ttttgcttcc ggaagctgtc    233400
     aggagagtgc ttcagagcat tgaagacggc ttcgtctcta aagtgaaaca gtttttacac    233460
     gcggagttca aaagtactta ggggtcgtcc gcgtatccta cctacaacgc caagcgcatg    233520
     gcgaactgca ccgtctcgta aaaagagtag ggatataaag aatgaattct gaaattgctc    233580
     ctatactttc aagttccgtg aaaatgctca agccacagat ctaattctgt ctaggtgtca    233640
     ggtcactccg tccactttca ttccgaaccc acctcatccg cttgtcttca gtcatctgtc    233700
     ttgacaggag tcaaagcaac acaaagctct ggaagtgtca aagccatcga agcgaagact    233760
     gcctaacagg agagaccttc cactgctgct tccactcctg ttctgcactg gtttcctcgg    233820
     ctcgcgattt gtcaagagcc actcttaatg aaacgatagc tcgaatcaag cgcgggtccc    233880
     cagaagggct gtttgcccgg ttgaaatgat actgcaaagc cagactttga gttgcgtcca    233940
     ttgtggtgct gacaagttgg tggaagctct caaaacactt gcaataaaag tcgttctcaa    234000
     gtccctgttg acggtgctgc tgtatccttt cggtcttcaa ttcggacatt gacatttcgg    234060
     gttgtgtttt ggatttcctc agtcgtggcc gggtggtttc caaggccatg gtagatccgc    234120
     tcgccataga gatttggtgg tccagtaaat ttatctcagg aagagatggc ttgatttgta    234180
     gggtagttgg tatggtagta atagggatag catctttggc tgtgtccgtg gatcgactgt    234240
     agatgcttga agtgttgtcg cgagagtaac cgggagttcg atgttggaaa gggttcatat    234300
     cggtcatgga ctgtccacgt cgcggctctc tgaaaccgac gtacataggg aacgggagtt    234360
     actagcgttt taaggacgga aagtccattt catgggcgaa acagtcaatt tgtgctctaa    234420
     gatagtttct aaacggcttc cctcacattc tcaccaccgt tgacgaaccg cgcactctta    234480
     gccgtagacc agcaccggca tagtgccaag ctagtctcta ggaatttcac caatgttccc    234540
     aggcgccaag tgtattgcca tactaagggg tggtattata gagacgtcgt atggttcttt    234600
     gacagcgagc gaacttttgt cttcgccccg ccacctactc gcgctttcag atttcaacta    234660
     acgagggcga ccataacacg tgtccaacag atcatatccc gcagttcgaa ttcagactcc    234720
     tatctagaat aattgtatga ttctaattgt tgctattatt gccagagtaa acctagtctc    234780
     cgtgcgtctt gcatttcatc ggggtgaccc gtcgagacct aattacattt tgtattctac    234840
     ttattaaccg gcttgaacgc caaactacag tttcacccag ctcataaccg ccgccgtttc    234900
     tgccccaaag caggctccag gaagtgaact agtcgctttg acccgcgata gcagtaacaa    234960
     gatctctgcg gcggccattc ttgatctcga tgatctgcgc gaccgaactg ggcgtaaacc    235020
     ttttgctcat cgaggaattc ctgcgccgat ttggggaaac caccaatcct ttcgcgaaag    235080
     gtatcattgg caatttcaat tgtgaccatt tcgtcaaggc tggtgacccg aaaatcaaca    235140
     cgcttcctga agtatccaca aaaccggcaa atgtcgacta gatctatgct tcctaaatca    235200
     agatcctgac cagacttaaa tctggcgccg gggaactcga caagcacccg ctgcaagatc    235260
     tcggcaggat ttggtctgga acaaagaaca gatccccgac aatgaaatga agccttaccc    235320
     tggatgggag tttcatccaa ctcaaagaaa aacattgccg acgcgagaat ggtcctcaca    235380
     agctcagctg gaactgcaaa atccatatcc gacatcgctt ccagcgagca cacatcgtct    235440
     aatccaggga gcgtcccatc gattgcctgg tctagtcgga aaatatcagg cgtcgacaga    235500
     tggggtaggt aattcagagc ttccaaaaac ccttgctttc catccataga tggagagcac    235560
     atcatggccc ggaacagtcg gggaagaggc ccctcccaga ttcgacccag tatgcccgtt    235620
     ggacgactgg ggggagatgt ggagaagcct gttccgacag agaggagaag gtcgtgtcgt    235680
     ttcgccatgg gccagatgat gctcgactct cgcaaagcaa tggcgagtgg gttgttcgca    235740
     cggaccccac cgtcttgcag gcaaaggcct ggcaactctt ttggttggaa gtagctagaa    235800
     aatgtcagcg tgttgaaatg tctcatggtg tttggactca catgggcgct gcaccactgc    235860
     atatcgacct gtcaaaagct aactgttagc aaggtcgact accactgtcc aaatcaactg    235920
     gctgcaaacg gtcacttacg cgtcaagtaa ggaagggtct tgtcggtcgt tgtgtggagt    235980
     tagaaactcg taggcggtat tggtggaacg tggacttgtt cctcggtaat tggctagcac    236040
     gcaggcttta ccatcagatg tgcggcttgc tacaatggcg atccggcaac ccgcaggatt    236100
     ggcggtggcg acatcgaaca tgcgacgaga tgggttaacg gctgctttca aaatcttcga    236160
     cagaccttcg gaattataaa aaccatctgt ggtcaagttg aacgccgagg caaaccaccg    236220
     gatacagcga ggaattgggg ttttggacga atgacaaaaa atgtttcgcg ccaggtgcgg    236280
     gaacgcatcg aaacattgcg tgaccgaaga ttgnnnnnnn nnnnnnnnnn nnnnnnnnnn    236340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    236400
     nnnnnnnnnn nnnggccact cggcgtacgt acctacactg gttccaatgc acaggtccgg    236460
     caaagatgcg atcggaatgc caatgcgact ttctaaaaac ccgtagaagg cccagttgga    236520
     tcagaccgcg cactccacca ccatctaaac tgagaatcac cgggggcttc gtcggaggca    236580
     gttggcgaac agtgacgtcg gacctctcct cgcagatggg acattgagaa atctcgaaat    236640
     ggtactcccc aagtcgactt ggctttccga agattacgac acaagtgtca catattgcat    236700
     gcttgcacgg gagcatatgc tccgggggtc gactcagaca gaccaaacaa gtagtggtgg    236760
     agcgaagacc accccactgg cgatacaagc gacacaacgt ctcttttcga atggctgccg    236820
     atgtctttac tgcgctcaat tgcgcaaagt ggtgcacgaa gcgggatgaa acgccagcaa    236880
     tatggtattt gaactcattg tcccagatgc ttagacatcg cttctcataa agtgcggcga    236940
     acaccacggt aggcgagaat cctgggcaaa ttagcttctt aattgagttg agagtatgag    237000
     tcaagaagga tggtcgtacc atgcatttga gggggatagg cgtccatcaa gaaggccgag    237060
     gctacaaggt catcaaagtc ctcctttgag tagccaatgg atgtttgcgt aacctctcga    237120
     aggcaatcgt ccattgattt gttcctcaca tagtcccttc gggctcttgc caaaagatca    237180
     aatggtgctg catgcaggag cctttcgtgg cgttgtacgc cagtgctcca gaaagcgctc    237240
     atatgagacg ccgagaagcg tcgacaattg gaaatccgct cggcctggac tatactgagc    237300
     tgcttaacga tcaatgtttg cagtggctgg aaaacgacgc tatctgaaag cccgtgacgt    237360
     ggacgcaggt ccagaatcgt gactgtccca gtatcgagct tttggagctg agcgcattcc    237420
     tgtgcgaagg cttctgttac atgttgactg ttggtcaagg cgatgactac ctgcagggga    237480
     gcgggaacaa cctcatcgcc aattgtaagc tgtcgacgtg gtctctgtaa taagtttgtt    237540
     gcggcttgga tatcagggac ggaatcgagg aataaacaca ggatctgggt ccatggtaaa    237600
     acgagttgcc tcttgacctc ttgctgtagc cttgcagggg tcaacgtccc gtctgcaccc    237660
     cctagtgaga aggtttgatg ctttgtcgtt ggattcttga gccacttgga atcccccaag    237720
     ctttgttcga ggcatagacc gctttcagca aacaatatag gattctgtgt atgggcggtc    237780
     ttggtgctga gatggagacg gatcaagcct gcggggcctt tccgtgtgat gttgttgtag    237840
     gggaacagag tccgcaaggc tttcttgcgg tttgaatttc cgtaaaagta gagcaggcat    237900
     ggatattgat gctttgggtt gggtaattcc tgcactagtt gttctaggcg gttggtatca    237960
     actaaatccc aagcttcatt ctccttgacg aggtcaagcc agagtgccat tatagagatc    238020
     gagagattga gagattagca aaaaaatggg cctactgggg actttatata cggactctca    238080
     tttgaaagtg actggcagtg acttacaggt ggccgacgct caggttgaag ttggcataac    238140
     cttgtctcgc ctcaaaatcc cctctgaacc aaaaatatgt caagcaccag attccttccg    238200
     ccagtgcatt cgcagatgac gctcgcttaa accaattatg cagcaacttt tgcgtttcgt    238260
     tagaagtcat tcgttttggc ttcggaaacc ggaccgcgta agtctcacag caaggcaaaa    238320
     atgcatctcc ccctatacta ggacccctag acctagttgg agcacgtatc atagtggcct    238380
     ttcatatgga ctatttaaag ggctggcacg gttctttgtt gatttgcctc cttacggtaa    238440
     ccttaaaatc ttttggtcat ggccttcggt gtggacgatc atacaagtac gccagcgaaa    238500
     acgggatcag aaaagactcc acttcgcgaa attgaccctg tgcttgttct gtcttgctca    238560
     gctgcggatg tggccccggc gctgtgtaga gtcaaccaga tgcaccacgc cgatgaaact    238620
     tcctatgtca gaatgcttag agaagaggca gaaatggata tgcgtttcag tatcacagtt    238680
     ggcgcggcta actgggcact gctggccggc tatctagtca ttcccggcac attcacttcg    238740
     ctgcagacct caaaccaggt tgaaaagacg ttgcaagcca acgaggccgg tcgtacagtt    238800
     ctacatatga tccagaaccc cccgttactc gccattgcgt gcttgctttt tgttagtgga    238860
     attgcggctc tcatgcggct gatgcatttc ccgaatctca ggggaaacta cccctggcta    238920
     atcaacaaag tatttgtgta agtgagcaaa tcccaactga aagaggtatg aaaagccaga    238980
     tccaactcta atcctggact agacccctat gcctgcatgc tgctgctggg ctgctgacca    239040
     ctgtcatcaa tgtttgtaca tctcaaggtg gggattggtc ggtgatggct atcataacaa    239100
     ctgctgttac tggagcaact cttctgagct gttcagcact tcttgcgctt tacaagttct    239160
     acaagctgga gcggatcaga aaagaagatg aggatattcg gcgttctcga gcatccacca    239220
     ctcttgatac gtgatatcag agttttcaga ccgaagagcc tggtcggaag tattaccgtt    239280
     gcatcgaggc tggtattttc catcttttct gtttttgatt ctacccctga ttttgttctg    239340
     tggaagccgt tttctgtgta gtttggacat gaatgtccac aaatagctga atgtgtacgt    239400
     agatctttgg gtgcttcccg atagttcact ccctcatcat gccgcacaac ttcctgtcca    239460
     gttttccggt ctccatccac taatcatccc gtatatcatc gtctaataac attcgtccgc    239520
     gcccaggaaa atagcatgtt caatcgtaaa gagattttcg tacggaagca ctcgattgcc    239580
     agtagattga aggtcagcta aatgactctc tacgctgtga ttccccgaaa tgtcaaagag    239640
     actgttcaac atgacagcca tagggagcta cgtacgcaca tgacatacga tgatggaagt    239700
     tgtgctaaca gaccaagctc ttaaattatg ccattaattg agtgccacaa gatttagttc    239760
     aagtagccat gttgagaaac gttgggtagt caaacgtgtt aagtaaccat tcataatatt    239820
     gcgcatgatc cggataccgt tgaagctatt tattaactaa cgttgatgtt tcgggtagtt    239880
     ggtgatccta atgccagcat ggtttattta aaggctaagg tgtaagtgaa atatgagagg    239940
     gcataaatat taggccaacc gcctttgtga gccccccttt ctactcaaat acctgagtcc    240000
     tatcctcaga cagatcaccc aaagcgcgct actcttggga attagcctgt tttgccagtg    240060
     cgtacggtaa gaagccccca ctccgcaaac cccattccct cgcaatatct ctaataaacc    240120
     gagcgggaca tagctaggag acaggtgttt tccaatagag gaatcaaatc tagcctgggc    240180
     caaatgacat gtctaccaaa gacctaacga ctaccgtgac gccggaaaca gtgcctctcg    240240
     cacaaaacca gtacgtagat caaccaacat caccgacatt gctatgttta tgggttgaca    240300
     atttcgagta ccgagagttt tgcatgtgat ataattacga gccaccctac tgtcggccca    240360
     tgtgtcggag acgaaatggc gtccactcaa agcatgaaga caacccgaac gccctcctgg    240420
     aacaacgctg ccttgccctt agctttgata attccaacat tcacactgcc aactgggagt    240480
     acggtggagg ctatcacaac agctcatatt cctgccccta cacggatcgg acctaccata    240540
     ccggctgaag ggtctggaaa tgtgttgtgg tcatcgacca ctcgatggct gactttatgc    240600
     tatctgctcc tcctagttgt caaaataatt gatgaaagtc gatccattta atttgctcaa    240660
     catcctccac ggaggagcag aatagggcta gctcacgata tctgtctctg tccaggaaaa    240720
     ttttattccc tgttgtcctt ttctgcagcg agactctagc aaaaaggaaa acaaaatgtt    240780
     ggatattcaa ggggaacagc atctgaacat gttgaaagta gacctgttag aatagactga    240840
     aaattatagg ctattttatg atgctgagca accgcacctc aactttccac acttcaattg    240900
     acggtggtgg aaatcccgat cagcagaggt tcactgtaac ctactataat tgcggcaatt    240960
     caccaccaca cttaaaaatc caatgtcgtt atgttgttac caatggactg acattgcgaa    241020
     gacgaaggtc atgtgtcaaa ataatatctt ggagctataa atggtttttt gacccttgtc    241080
     catcctcgct atgttttttc acgccgcgaa gccaacacag cattatgaat cgcgctaaga    241140
     tcaaacacag ccgaccttct accgtgtggc ttgatgagtc ggccttctgc aatgagcagc    241200
     tgagtccaaa ctcaacggcg tctccgcata tccaaccccc aacaatacag aaaatggcca    241260
     ccgccgtaat cacacctggt tcaatggagc cacacccggg tcgcccgaac gcaaggatca    241320
     cacaactgaa tcagaaccca tgggatactt ttgaacctgc cgctggatca tcccaagatc    241380
     ggtctctgat atttgcccga aataagtcgg aaagagggaa gttggtgcat atccaacaac    241440
     ttgaaaaaca gttctctccc gccacaggtt tcctagaact gatggaacaa gtcgcccatc    241500
     caagcttcct aaaattgctc gaatgttacc atcatgatgc ttcatgcaca ttggtttggg    241560
     aaccaacgga agtgtcagtc agtcacattt tagcctccag ctgctcgatc accaccgatg    241620
     aactcgttgg aattgtcaag ccggtgagcc aataaaatct cttgcgggtg cattcgaaat    241680
     taacttggaa taggtactag aaggaattca atatctgcgc gggctcgggc gagcactcgc    241740
     taccctaggc ccggaaacaa tcctgcttac gcagtctggt gatgtcaaga ctagtgaggt    241800
     atccgcggat attgcgaaaa ttgatacaaa ctgactttca atagtgggcg tcgagaatag    241860
     ctgcgaaatt aaagaatcag aaatgaatcc tgcgacgatg aagttatgcg ctctagccga    241920
     tgttgtcacg aaattgatgt tgaaaaatcg tacatacgag tgggaaatgg agattcagaa    241980
     cttaccttgc caactggaaa gtatctccgt cgaggaaatc ttgcaggtaa gttcattccg    242040
     tctcatcatg ttctcggcta atgtgacaga atgagatgtt tacacgagat tcatgcgagg    242100
     gagagttgaa attgttggtc agtgtagcca acaagactgc ctatcacggt atcaaatctt    242160
     actatgctcg ttgctgaagg acaaactcat tggcttttgc tcggctgttt tttgaggcct    242220
     accaaatcaa gaaggaaccc gcgatcctat tttccatctg tgctgttcag acagtatatt    242280
     attggtgcat aaggaaagct gggtacgcag attggtagat ggagtatgct tccgatggtg    242340
     gtagtttgca aacgctcttc aagcgaacaa atatagtagg ttcaggatag cccctcgact    242400
     acactcaatt tgcgacctgt tgttataatc agttcttact tatatgaccc atcggtattg    242460
     tcaatttttt ttgcaatttt ttgcattcgt ttatcgccta tttaactagg gtctatgtaa    242520
     cacaaggagt gcgttgcttc tgtttggatt tgagacataa tcatacccgc tgggcaaaat    242580
     actatcatta tctcgcagat gtgctccccg ctggaactat aatactgaaa ccaggtttgt    242640
     aatcaacaaa gggaggtgaa tattattaga ctggaatttt ccacttcaca gacgatctgg    242700
     attgagctag atgggtctga acgctcccgt ctatatatat ctgcgatgca ggaccccatt    242760
     gctcatcaga atatttactt tacacaagtt tggctaccct ggcagccaca cgaacaaggc    242820
     atcgagttgg cattttcagt agtggaatta gcctcgccgg tgttggctgt atcggtgatg    242880
     ggaattaggc cgaacgtagg attttcggtt cataccggtt cgccttcttg cggtcgatat    242940
     ttgctgtcgc cattatattc aacaatactt ccaggccaag ggaagtgaat gtctacattt    243000
     tctctggtaa tgcaaccatt cacgttggcg atgaacatag caatggacgg tcgcaagtat    243060
     catataacct tagcaccgaa tttcttccgt ggccgctagt ataacctgta agatggatgt    243120
     agatacctag aactcaccat agttgcccag gtggttatat ggtgttgtaa cctttgtcat    243180
     ttttgtggat atacagactg tcacgtggtc aatagctgcc cgaaaggtcg accttgcaca    243240
     ctgggcggca atgatccatc atttattcag ttcgcagcaa ccaaaccacc aaggacagac    243300
     tgcgcaccac ttttcactgt gcttcgagtt gcatgcttct agtgtgtctc aaatactaga    243360
     ttgagatgtt cctcgatcca ttaccagccg acacaaaacc ctctatcctt tttcgcgctg    243420
     agtgcagtag caacacaagc ttcagagaag gctacttatg tgcacggaaa agagaaaaaa    243480
     ggccgccatc acggaaagac tttggtgatc atctctcttg gaatcgaaaa cccacgcggt    243540
     tcctatcctt cggcacttgg aggcgggcca tgcagcaacg caaaatacta gaggatgaag    243600
     gaagagttga cattgttgtg attgctgtat gggtagaggg tttggcaggc gtgtatagtg    243660
     cggaggaagc tgcttccagg cttgaatata tcgatacagg gctgggtcca agaaagtcgc    243720
     cccaccatga ggaatacctt gttgaaggtg gcattgctgc tgatgaatat cgtatccttg    243780
     cggtcttcga ggggggaggc cttgaaaatg atgctgtctt cgaatatcct tcctatcgga    243840
     tacaagcaac aattcccagt ctatgtttcc ttgggcggag atcaagctac gcactggagg    243900
     atatagggaa tgagatctac agtcattcgg gagttcgcga tgatatgaaa cgagatgtgc    243960
     ttgtggaagc aatcacggga aatcagctgt ttttcccgac tttgcggtac aagtacccgg    244020
     gccaaagtga aaacctcgct caccaccgaa ccaagtctat caccaattaa ggatgtcgga    244080
     ggacctaaaa tcgtcacagc tcgaacaaat ttagcatatg ctttagattg gatcactgaa    244140
     ttgctccgaa atcgcttttg ttgctaactg ttgctgtcaa aacctggggg gggggggggg    244200
     ggtgggggtt ggtattttac cactaaggac agggttattc gtcattctct ctttgtccct    244260
     gcatggtaaa cggggtacac tcaacattcc agcgtcataa catgctgaga acgactcctg    244320
     ggatccgata acgcttcaac agcacgatcc agatagaaaa caattaatgc atctcaatgg    244380
     gacacctcaa tattagcata taccagtatc cgtagcgaaa agaaagtgta attttggtca    244440
     tttgtaatgt actgagactg ttcttgctgc ttatcattta cgatcatagt acactgccag    244500
     gaactcgatt ggaattacaa cagtggtgag gaagttccaa agtcaaaggt gaacattcga    244560
     gcatgattgt ggtgcctctg agcaggccca gctacacagt ttcatccttg tcattctaga    244620
     ccaggggaat ggtccatgtg gctgtaaaat actgcggaca gtgtataagg attcatgata    244680
     ctatgcgcgt tcccataggg agataggaca gggtagcaag gagaccctgg gactgaaagt    244740
     atctggaacc ttgttagctc aagagaatat ggatgatttg gtttgattga atcggtggtc    244800
     gaaaacagag tgatctatgg agtgaatccg atttgctttt gacccacgcc caagtcacaa    244860
     ggaaatcaaa gttcgacaca gaccacggaa ccacgagcgg gactgccgat caatagcggg    244920
     accgcaaatc atttcgagag ctcgtttgga tgaaccatgg aaatgcccac tcggtgagag    244980
     aatgcggttg taatgaagaa ttcaagtctg ggagttttcc cacctacctt ctgggatgct    245040
     cgtgattaag ccttgcagcc caaaagaaaa gagaactaga gcagaatcac tacaatcttc    245100
     gtcggctggt atgtaggata aattcactgc ggtaaggcca atatcttatg agagactttc    245160
     tttaaattca gcatcttgat caagatgtgc agatcgattg aaataaggtt tagggccgca    245220
     ggatggccgg cccacatcga aatattgtcc ggggccaatc ggttttagta aaacggaggc    245280
     attttattta agctcatgtg gtttgtccat aattggcata gttctttaca agccgtctgc    245340
     tagagttatt gaaatagcgg tagatttgaa gagatggaga ggaagtgttg ttatggtcca    245400
     aagagagcaa taaccatcgg agaaaggctt attgcaggag aagatacgta gcttctagaa    245460
     cgttctacag accagatngg caaagttcag cttgccactt gacaggggaa cttaccttct    245520
     catgactgcg accaagaaca caaccacgga tcgggttgta gcctatcatt gtgtcgccaa    245580
     agtctgcgtg ttattccaaa tactcacctg ccccagcagt accgcctagg caacaacccc    245640
     ccgttccatc ggaccctgac agcggccaac tttgggcttg tggatcgtgt ctggaccttt    245700
     gcaattgttt ccattttctc tccacaaata gagcctccct gatctactgt cccctgggtc    245760
     gtcgctgaga tctgcatcgc agaaccctac ctgcgtctgt ctgaattcac gcgtggtgtt    245820
     tgattggccg gtcgggtgct tttcgtctcc agggtctcat cagtgtaata gtagcgttgc    245880
     aatcttgcga gggggtggcg atcacgagaa cctagctcgt gggccttggt tgcatcagtt    245940
     cacatggttg tcctggnaac tagacccagt ttcttgtctg agcttttcaa aggtctgggc    246000
     cctttttggc tatcatgcca aagaaagaca atcttcatcc tgagattgca agtatgccaa    246060
     ggcctacgcg cccagggagt agagattttt agtaaagaca ncataagtca gctgcgagta    246120
     gaaatgaaag tcagcggcgc gagcctagag atgaagggtt gantctagtg agaccaaaat    246180
     gtcatccggc caaccccagg tacagctcag cgtttccgtc gaccacaaag tctgcagccc    246240
     attatttcgg catctgtcga agcacttcaa cccctcatta agaaatggta accgtggtta    246300
     aaatggggac atgtagaatg caagcgcgtt gagcgattta attgcaaatt cggtgatggg    246360
     tacgaatgtt acttttgcgg gcgttgcttt cttttcaaca gttgatgaaa gtggttcacc    246420
     acactcaacg cacaattttg agaggaagta ggccaggtcg agacttggct ctgtaggcca    246480
     caaagtctcc aaacacccct tcaacgtcgt tgcaatcgct tcaacgctta ttaacgagac    246540
     ggtgactctc gctaccaact gcgcaactgg ttccttggta gagacgtagc cgaaaaaata    246600
     taaaaggagc ccgattccca gcccaaaaaa aatcaggact tcggtcctca cactccgttg    246660
     tgtcatggtg tccctctctt gcctgcgggc ttgagagtct ccgtgaccac ggctgtcgct    246720
     gccacgagcc cagtgatgta agacttgcgc tccctcgctg ccacgagccc cgcgagtgta    246780
     aaaaggtgct tcgcaggata ggtctgcgtg aacaacaatc ctcgcagggg ggcgctgcgt    246840
     taccaagtga actccgcagg gggacgctgt gatgacaagt gagacccgca ggagaccgct    246900
     gcgttaacaa gttctctgca ggagaccgct gcattaccaa gttctccgca gcctaggtcc    246960
     tgcgtcaaca aagcgtctcg cagggacatc tgcgacaaca agagtctccg cagggacatc    247020
     tgcgaaaaca agagtctccg cagggacatc tgcgaaacca agagtctccg cagggacatc    247080
     tgcgaaacca agagtctccg cagggacatc tgcgacaaca agagtctccg cagggacatc    247140
     tgcgacaaca agagtctccg cagggacatc tgcgacaaaa agaccctcta gcccgtgcag    247200
     gcacctcttc gtggtgctag ggaccagtat tcgagtattc aagagtaccc gaagaagcaa    247260
     agacctgcgc aacatcttca tcgtctgttc attgttccga agggtcatca tcggatacat    247320
     agaaggagcc ctagttagat cttcgccaat tcaacagcca aaatcataaa ctaacaactg    247380
     aagcgtcttc attatcaaat gacgtatttc acattctttt cccttggtag cttgtgatcc    247440
     aataacttcc tcgatacaat aggaattggc atctttcatt cagatgtagg caaacagaga    247500
     tgagtgttgt cttgaaatgc ttgtggtgtt taaccgttag tgttgaaccg ttggtgttga    247560
     tgtgagtgtt gatgtgagtg tagatgtgtg tggtgactga gcgtggtggt gaatggtcgg    247620
     gcggtgaagg aggtggtcaa cgtctagacc atgccaccct cagattatgt aagattcctg    247680
     aatagggggt tcaactccaa cttctggatt aatcggttat ttacgtctat cactgtcacc    247740
     taccgccgta accactggta tagtaggtaa tcgatcctaa taacgttgta tcctgttata    247800
     tgatttatta tatatgttgc ttttatgata aatttattgg tgagactagt agacagtatg    247860
     atgtgagtgg atttgtaggt tcaacatttt ttgtcgtcat atatatattt acacacattg    247920
     tactcgcatc actatttcta tttatttcag ttcgcacttc caagtttcat tcagactaga    247980
     ctcaacagtc cgctgctttg acaagcttgg ttcaatccat ctcgtccgtt atatatcctt    248040
     ctacccaact aatccgaaca cgtagtattg tgggacctgt acgtggctaa aacattgtaa    248100
     agtaaatgcg tgcgtggagg gcttgttgac aagcggctca tggcccaacc aacgccattc    248160
     ccgcccatag gcaggtggaa gtaacttatt gcgaatccat gggcctcatg ggccgtgtcg    248220
     aggtcgatca atacccccag acgtagcacg gaggttttct tgccatctca tccacatgat    248280
     agatgaatca atttgtattg atctatctag caagccatct atttctagtg ccgtactgat    248340
     cactcggtgg atttgcatac agcccctact tcgattgagc tggtcgaaag caaataccag    248400
     actgccctcc gttggtcaac tatgaatagg caatacatac gctcgagatc agacctacca    248460
     ggtgtcgaag cattcgatga ggagccgctc gaaatatcat ttgtggccca actaaacatc    248520
     attgatgcga tagactctgc tctgccttgc gtagtcgaag tcagagcttc agttggcgat    248580
     ggcaagtcac tcaagcctac tctactgtag gatggttata tcctaaaacc atcgcgagtg    248640
     tgataatgga ttcgcaacaa agaaaaccaa ccaagtatat ccgatcggct cctacatttg    248700
     ggactcgccg caacattgta agtaatcccc ccgttggtaa ctagaattca tattgccagc    248760
     cgtaccccat gtatcaatat ccagtactgc gtccgaaccg ccggtcgttg ctttctgggg    248820
     cgtagtaccc gggttcatgc gatcaagctt gctctgctgc cgatagaacg cagcaggatg    248880
     gctctgggtg gtgttgttac agactgagac tcatcttcac aaaggatctg cttgaacaat    248940
     gatctgccaa atgtcgtcca gggcgtggtg agtttgacaa atatatactt aatgctgaaa    249000
     ggatgccgac gctggaggac agaatccgac gaggtccctg gcaggagctg cttgcgcgat    249060
     aggttagaaa acgacatcaa tagacagaga caggcgggca gcttggtgac ctgcagtttc    249120
     agtgacatcc aaagcatata cgactttgta aatatttatt gggctttgac agagaaatgg    249180
     gtgcttggga tccaaatcta ccaagcacct gttccaagga gacatttctg actccgactt    249240
     gatgaagctc cgtatatttc cgcttggttc atttccgctc gttcgtatat gtcgaacgcc    249300
     tgagcaacac gaagtacgag gtgggacagt gtcggacggc atttttggct ctttagttgg    249360
     ctcaactgtg tctcggtata aacggcgttg tcttctcagt tcgtagctgg taccgaaatt    249420
     agtctgtagg tcagaaacga agggagtttt gcctcgcctt ctccttgcac gtggatttgg    249480
     actaacaaca tggccaacgg caaaggtagg gctcctctac cattaagcaa gacgaaacat    249540
     cgttatttcc cggcgcctgt gggaaatatt cggctttaaa acacgccaga ggccatccga    249600
     gaacaacgcg gggccactca ttggacgcca gtaatccaat tcacgagggc tattctttca    249660
     tggtgttgga atgcggaaag acacaggtgg tataagccat tacaatttgg cgtatgtatc    249720
     gcgtagacac atcagcatat gacctgatgt acagagtcga cttgagagag aagggcgaag    249780
     gtaaacgcga tcggaacttt acattggctc atcatcgatg tcaccaatgg tcatgtcggg    249840
     atgatagagc atgggatcgc atcggtatcg gggagcccca gcagacaatg cacttgcgcg    249900
     cttcgactcg agtaacggga acatgacggt accccctatt gtacaatccg attcagcaag    249960
     gcttgaacca ccaggacgag tggttatgac ttaccagttc ataaagatcg cagaattttt    250020
     gcttggaacg agacgatcaa ttagcttcgt ggtcatatct taccgacgaa gatcacttac    250080
     aatcgtcttc agcaatgcag tcaccattca tgccatgttg atatgatgtt gtatccagtt    250140
     tgtcgcactc tccggctatc tctccggcta tcacttcgaa gaagccgcgc cggatgcacc    250200
     gggcaacttc tgagccccaa aggcgcgcga cgaacccacc tgtgacaaga aattgtacag    250260
     tcgtaatggg ataagacctc gcgatacgga cggcgaacat cccaccccac catcatggtg    250320
     tgaaggcggt gaggtcgaag ggggaagacg cgatagagcg cgcgtcgtag gtcttatctc    250380
     cgacccggga taaaaggtct cctcacaagt atgtttcacg ggtggcgatg ggctgctcct    250440
     atctacaatg gcatgaatat cagcaagggt gttcgtgttg tggagcgcaa aatattgcac    250500
     aaataactgg atatagtgca gcagaaggcg cgataaatca cttacctcaa cgggaagaat    250560
     ggacgtttca agcttctata cggcgaattt cgcaatcgga tgttcgcacc ctgttattgg    250620
     cccgctcctt ggagttatat actttaccta gggtatgctg tgtggtatga agcgacggga    250680
     caaggtctgg tgtataatag gctatggctt tatatagcac taatggggtg ctttatcctc    250740
     ggggccactc tggtgcgatg tcaatggttc actgtcatca ttagcttgta gatcggtaag    250800
     ttactccatg acttacatgt tctgttggca aagactaggg atgaagagac gacaagagct    250860
     gcggtccttg cgcttgtgca ttgtggtcga ttgtcctcgg ttctagatct cctcttcagg    250920
     attagtagac ctttagacag gtcaggctaa gattcacata cctgcggcgt ggatattcgc    250980
     gctcttgcct tgggaataca cgcagggctg tactagatca gctcagtcgg ctgaggcgga    251040
     gagacatcac acatcttcgc atagacgttt ggaccagcca gcccaagtct tgtctctttg    251100
     attggctggc tgtaaagtgg atttgctgag aacaatatct tccacaggca ccgtatggct    251160
     tgctggttca tgttgtattc tactgtacaa atgttagtac agtacgaatt tcagtactgg    251220
     gtcaaaggga aagaacttat caagtgcctc agacaaggcc tgcttgactc tgggtggtca    251280
     aatgtgaata aattgtagag caagttgccc gggggtagaa gacgtattta taggtttctc    251340
     ggctcatcct gtttctcaag tgctctgctt ggtaggaaga gttgagacac ctcctaattg    251400
     aggcctgttg aaacccgtgt ctccttttca ccgcaattat ttccagcggc agctgctttt    251460
     gcctttagat gctcagcgag agagactagg gatgctgagt cggtcaagaa acgttggctg    251520
     actgttgaaa ccttcacggc cctcttaagt tgaggcttcg tgggagatat tcaatccgca    251580
     atgacacgcc cgtatttctt gtcctgatca cctcatctgt gagcgaccca acgttgaatc    251640
     accgacaagc acctacaaat tcatcactag caatcgtggt ctttttcgcc tggcctcgct    251700
     ttagtgttgt gttggttgtg ttgagctgtg tgggtctgtc catctagact gcagaaaagg    251760
     tcacggtagg atgtgcgggt gctcgacccg tcaaccgttg aagcttggcc acacattgtg    251820
     aacactcaat ttcgaacttg cgactttgag gagacattag tcaagccttt tttccgtttt    251880
     attttttcga acttcttttt tttttgttac tatgagtttt acaatgttct gtttatcgat    251940
     ttctgagact ttcaacgaaa gtgaagagat gtccggttga agtatgtctc cccaatgagc    252000
     gttcaatctt gcccttacca tattgaggct ttattagttt ccccatcaac ccattgataa    252060
     ctatcccttc tatcaaattc actcctaacc acccacaaaa attaaaaaca aattcattca    252120
     aaagctgtct gcgttgattg accaacctaa cctcggtgat cgtaaaatca agtgcatagt    252180
     caccatattt gcatagtcta taagatcaca ccaaggcctg atggaaacag tattccccag    252240
     gtcttgaatt tctcctgcgg aaaacatgga tgccgcgaat agctcgccag accaggaaaa    252300
     aggagaacag cagcccgatg aattgccaag ccttagtgat aaggacaata atcaggaaac    252360
     ttctgataat gttcctccaa tggtaagtaa aatgactcgg cttcaaatgc tttggctaac    252420
     catcgcagcc ctccccttcg caacacgaag aagaaacaag acataccttg gcgaccgagc    252480
     cctttcaacc catcctgaat gtgctagcag acctcgaacg cgacgatccc aagtttgcct    252540
     ttccagcagc ccgacttgtt ggactctatc gacgcctatg ggagtcgtgc gtgtccaagc    252600
     acattgatgg acagaagcta gagcagagca accagatctt gaaggaggct ggtgcgtccc    252660
     tgaggaaaga gagggacggt ctccagcttt accacaagaa gaagctagct cgactgcgct    252720
     tttttgagca ggcactggaa tcatctcggg aacggctgat tagcctactc gatgactgga    252780
     actaccccta caatgccaat ttggcagggc tgacggacat cgcaagagaa gagtaaggaa    252840
     ttgcctattt cgggttgccc tgtcctatat tggcaacata gaaatactac aagaaatact    252900
     acaagcggcg acggagtgct agggaaatta caccgcatgc aaagcaggct atatattccc    252960
     gagactttta acaagaaggg caccaaatag tcattattaa ttatcgtggt ctttaatgaa    253020
     atgagtatac gaacaatccc gcttgattca gattaatctc gctcgtaatt actcgatata    253080
     ttatgtacaa aaagacatgg gtccagggat agcgtcgggg gaagcctagt caacagagaa    253140
     tgtggcgaga gactcgcata cggtagagat tccgtacgag gccaaaggga cagtcggaag    253200
     ctagtccctg tttcatggac agcatgccag gtgattgtgt ctagcaacta actgcgaaac    253260
     cggcacagat ttcccagggc tgtttcaacc cgcggcagaa agaacaggtc ctctcctatt    253320
     gcctcaccag atacccggtc aaatcgcaca aatcgaaatt ctatccactg cacctcttta    253380
     gggaaaagga gcgctgacat gtggaggaaa atgtcgcaag cccgagtaga gttggacaga    253440
     ggatctggac ctgtccactt gaagccggac agactgtcga gggtggggta gaaaaggcat    253500
     tcgataaagg aaaacccttg agtttcgtat tctgcaggat cgtctttgcc aaggaaatcc    253560
     tgccacagat cactgggatc agtagcgaga cagggaggcg gtgtcggtat gccagaagat    253620
     tcatgccaga tagcgtgaag gtcgagatcc aaatcgtagt ctagtaatgt tagtgcaagg    253680
     tattatcaag gcaatgggta cagaccgttg ttgttcagtt cgttcatttc tgttataaga    253740
     cgaaaatacc caagtgtata aagatttaac gtgggctggg aggaatggaa agctggaggc    253800
     tgagcagtta ttttattcct ctcttattac acagaatcag aacaaactag gggaatttat    253860
     agctagatgc taagttatcg aatgcgttga acgtatcaac agcgtgcacg ttggtacccg    253920
     tcaccaaccc aaggaaaatt caccaggagt ataagcctta actctcctta gagaaaacag    253980
     aaatagatag cggaaaatca aatgtcattc tttctgccca taaatgctct accacatgga    254040
     gactttacca aggctcaggc tcatcgacag agtaggcttg aagatcgctc gcttccaagg    254100
     ctgaaacaag accattacaa agagcctgaa cggctcgctt gcgttcccgc aatactgaag    254160
     cttgcacatt ccagagctgt agaaggacat cgctatcgct tgctagcaag tcatttgacg    254220
     cttgaagctg tcgctgctcc tcctcgagtc gtattttctc ggccgatttg acgacgtagc    254280
     attgccatag acaaaagtac aagtcaagca gtttgaggac tggtgtagcg agggagtcat    254340
     tgaggcttac tactttcatg aactccccgg taagggtacc gcgtgttctc actgggatct    254400
     atttagtatt agtgggggtt tccattcctt gccgtggggg atatgaccga ccttgggttc    254460
     gatggttgag ccgtttgtga cttgctgtgg ttggttttcc aacttgggtt catcttctgg    254520
     agcgtgagat actcggcact gtctcttggc cggccgatca atgggggaag gcgaagtggg    254580
     atggtccatt ttggtcatca agatgaatgg gatcagaaat tatgctagag gggcatttat    254640
     agctgacaat tcacgtgagg ctgctgttat tcctaccagt gcttcctcac ctagggtcga    254700
     ccgcaatttt gaagccagta aacagttagc tcaaccgctg acgctcgatc tcaccacctg    254760
     ctgagagcaa actgctcagg aataagcggg attaaatcgc atctacagca ttgacacgaa    254820
     ctaatgcaaa gactgtctca taatggtagt ctgcaagtgt acttccgatg cgtggatgct    254880
     ataaattact ttcaaatcat tgaagctttg ccgtgactcc aaaccattcg aagtgcggca    254940
     gtgcagataa tctgattccc aatgttgatg tcaacaggcg ctggaaacag ccatctcgta    255000
     tcacatcacc agagctacct gaagtagatg tcgctagccc ttacaaacga tcaaatattc    255060
     tcctcggaga ccgtttcaac aattttttag tagtgttgtc gtcgcaaatt ctgcttcgaa    255120
     tggccttgtg gatgcaatag tccttcgcta gatccaggga tctgctcaaa ctgaagtgtg    255180
     tcagtctggg attggccaca agtgcatcaa caatcgagaa atgtccaccc ctgaccgcca    255240
     acatcaatgg gtcctcgaac cattgattcc tcaggttgac atcaattagg ccatggcgta    255300
     gtatttcccg gaccatatcc aggtcaccgc cacgggcagc aatgcagaga gcagtgtcat    255360
     gggttgcgac tgtgctacat taacattcag acgtgcgccc tgctgtacta agagtcttac    255420
     cacatcgaga tgaccatgtg aaaccgctcg acaaatgggc ggatctatta aaccccttcc    255480
     attgatctcc acgccctcca tactcagtaa acaagcaatt gtcttcacgt gtccgtgata    255540
     tgcagcaacg gaaattggag agtggcctgc aacgcagaga ctcagagcaa tccctggcac    255600
     tgcaagcagc cgtcgtagaa gtatagtatc caatctcgtt gcggcatggt gtaaagatgt    255660
     agacggggcc tcaagtctcc cacggcctcc aacgaaatta acgtcgatgt ctttctccgc    255720
     caagagcctt tcggttatct cgtcgcatga cgagtaagta gacagccaaa gtggcgtatt    255780
     gccatctttg tctttgcagt tcacgttggc aagggggtgg cccaggatca aatcgaccac    255840
     ttccaggcgt ctgctttgaa cggcgagatg gagcggcgta tagcctttcc ggtcctgaat    255900
     gtccaagttc agatcctttt gtctaagacg ccacttgaca gcatctatcg acccatgcaa    255960
     cactgcctca tgaagaggta gctcggaatc ctgagcattt cgggcaccta aataaacttc    256020
     acagtcgggg ccattgataa acattatttt catgacgggt ctattgattc gacatgccca    256080
     agaccacgcc gactggcctg aatcatcttc caagttaggg tcgctgccac ttaaaagtag    256140
     cagttgcacg aatcctattc ttcctgcgaa gactgctagg tgaagcgccg ttcgcccgta    256200
     tttgtgttta atgtccacac tggcggcgcg gtgctctagc acgctcttga cgatggagga    256260
     actcccgtag tggatagcat atgacagggc gctgtcgcgc gcttggtttt ggatgttgat    256320
     atctagatct cgttgactga gcagcagttc gcgcacagca gcggaagagt atttcaacgc    256380
     ccgcatcaaa ggagttttgc ctcggtaaaa tgcattgatg ttggcgttgt gctggagcaa    256440
     agcatccgca aggccaacgt tgtcgtattt gacggccaag tgcaacagat tgctgttctg    256500
     aaatctaatg ttgtatttcc aggtgctggg ctgcagtcta aaatcaaggt ctttgcatga    256560
     tttggcgagg gcgaataatg cactgccatc caaatgcgac acgatccaca gcaaaagctc    256620
     gttgggcagg tctctgatgt ttggctgtac tttgttagct catccgtaac ttcagtaaga    256680
     aagaattgga actgaccata gtggaacagc agagtagaac taggaatcaa ataaattgta    256740
     gatgagggtg aggtgtgggg tgtgaaagtt gcacgtggag aggtccttat atacttgcct    256800
     cagctaaatt ccgcggtcac atagggtgta gcacgtcact ccgctgagag gtgcgtagca    256860
     atcacgcggc agcatcaaag tcttgacaac aatgtttagg cgggtgaaag aatccttgga    256920
     ctctagctcc tgggaacacc aaagctgttc ctggtagttg tcgatggccc taggaaccga    256980
     atctagtctc tacatgccca cacctcggat ctagcgccat aggcgtcgaa gcaaataaca    257040
     atctaacagg cacttcgaaa cttccatagg caaccaagaa tttaacctag catttgtcga    257100
     ctttgctgcg tcccaccgca gccaacctgt tcgccaatgc atggtcaacg caacctacag    257160
     ctacaagtgc agctgatttg ggcagcagtg atgtggaatg atatcccttc ttgcaggcca    257220
     ctgatcggcc tataccggcg cgtactgcat ccaaatgcat tcttcgacgt accaactgtt    257280
     tcaaggaagg cgttgcatgt cagcagccac gcagccatgt atgtaaggag gctacggcga    257340
     tggcatataa agctgacgag ggaacactgc ggagattgcc caacatcaac tcccatccaa    257400
     agtattttct gccttccaag acaacctcaa tgactaccat gccttggaac ccatttgctg    257460
     tctgcgggat ccctcacggt ggtcctgcgt cctgttgcgg ggtgacgaag aaaggccagc    257520
     cgtgcaaaaa ctctgtcaaa tttcaagaca ccaagatcgg ccatgaaagg ttgaccactc    257580
     tcgccagaga gccgtttgac ttgtcagctt tgcagtcaaa gctatgtgat attgctagag    257640
     ccttcctctg cgcgagatgg caccgtcaac agcaggccga ccaagttggc cagcggtggt    257700
     atgaagcagc catccgcaac caggcgcgag tgccgcatgg ctctagagtt gccgctccat    257760
     ccattgcgca tccgggccag cgtcagatgt cgtcagtgtc caggagtcgc cctgcaccag    257820
     gcaacaccga caggtcacct cacgggctca gacaagaccc accggtgccg ctgtcaacca    257880
     accccgagcc agtgcaacca ttcaatccat ttgtgacttc cacaatgctg cggacaaaca    257940
     gtgttccatg gcatgtttcg ctggctcaac cagcgatcct gacatcggtc gctaacgtct    258000
     gggctggcgt ccaaagcttg acgctcaagg atctcaccct gagtgacgag ttcgacgaca    258060
     tccactgtgt attttgtctg gccgaggatg atgaccttgc aaatgagagt gtgatcttgc    258120
     gctgtcagtg caaggcgctt tcccacctgg cctgcgcgga agagtggctg gaaaaacgaa    258180
     ctacgggttt tgggacgtca tgctgtgtgt ggtaagtaag gctaattcca atgatgcaat    258240
     acccaagatg ctgattaata cagtcgaaat gaagggcctt tagacgcctt ggttcgccca    258300
     ctacgagtcc aatcgtcgga tgctgagaca cgtcatatcc acacggcaac tgaatcatct    258360
     cccgagagag aacttgccac tatcaggaat ccatcacaaa atgacccgag tcggagtcag    258420
     ctgcgacagc gctcagtggg accccaaggg agatcagtcg agcagagtgt ggataatggc    258480
     ccccgtcgct cggctaggct aggagctcat ctaccacgag gcccttctac gtctgcacca    258540
     ccccgccggt cagcacgact aaactccact cgaaggtgat cttagtttac agcggaggtg    258600
     tgatgggaat gagaaattag cgaagcgact gtcaatcaca ggtgaagaca cgtgaccaga    258660
     cacaccgcat tcggcccagc aacatagagc atagccgtgg tatggagttt tagagcaagt    258720
     ttagaaatga tgcaaatgaa attctgaatg ttcgaactcg cagagcacca aaactaaaac    258780
     cacgctacct tttcatcttt gcaagtacta gatgctaata cacccccaag gactgtgggc    258840
     agtttcgctt aatttttttt ttagatcgaa accatattca tacccaacgg tggtggccaa    258900
     agaactgtag acatggattt atctcagtgg tgcgtgtcgc gtcaagacgg agattgttag    258960
     cagaagaaaa aacatctcgg gccggcgagg ggctctggca aactcctatg ctggttagat    259020
     tgactctggg aatcaatatg ttaaccctgg gaaacaaaag catttctggg agctgtatat    259080
     cccctgggaa atacacctta gcttgccaga gatcgagcat atatagtagc ttgggtgttt    259140
     ggtcgctgac caaacattgt gcctttttgg ccagatggcg tagtggtaaa acccaagcaa    259200
     ccatgaaccg tcacgattat gctcgatctc tgacaggtat tcatttacga ggcgtatcag    259260
     accgcgtgtg atcggcggtc ttgtttcgga ggtcggccca tccttggacc ccacaacact    259320
     gtgttgaacg gaacaattca tctttctgag gcactacagc acagttcagg tgagttgcct    259380
     cccatttttt tgatatcctt ttcgtctctt ccaccaaact gtccgctgcg cattgactgt    259440
     tgtgatagcc gcaatttgcg aagacccatg aaacaggtac cgatacaaca gaaattccct    259500
     ccaaccttac tcatgtactt ctaactagca ccaactgcat cactaaaatg aagtacagtt    259560
     caccaggacg cacttagatg gcaagaagaa tattcgtatt ctataccctg ggagctatgg    259620
     aacttgtctt ccaccattac tatataatct atgagccccc agcttgttca tgggcccaaa    259680
     acacccttct tgcgattctc agttttggct cttttgaagc ctctgaatac tatgccacca    259740
     caaaccacca ccatcataga tggagaattc gagcgcctta agagcataca gatgaacgcg    259800
     ctggacaaga atgtaatggc attcctcgaa gcaactcaca agtcggtcca ggccaagggc    259860
     atatacaacc caaggggccc ttttgagagg tctctcatcc attatgccgc catgggggac    259920
     tgtactgagc ttctcttgca acttttggag acagaagcgc caatagagga tcgcgatcag    259980
     aacaaacgca cgcctctctc ctgggctgct gaatacggct cttacaatgt gacgaagatc    260040
     ctggtccaaa acggagcgca ggtcaactct ctggacgata cgtacacgtc gcccctgacg    260100
     tggctgaaat acgcagggca ccctgattgt aaaagcctcc cagccaccaa aagatttctc    260160
     aaaagtaatg gcgcaaccac aagagggttt aaaagggcct ggattttgca gaagcttgga    260220
     cgtctctaag tgtgttatag ggaaccctca agtacctttc ccgacctagt ccttgttgat    260280
     cgtctgtatt tgactgcgct tgttattgtg accttggggg atatatactg tcatttatac    260340
     tgtcatttcg gaaggctgtg gtggcttgtt acgaaagaat ctatgctttc tttcctggtt    260400
     tttttttagc actaatacac gtctccaata aacattcatc aatggcgatg gcgcttttac    260460
     tcctgtttct gtattagttg gcatatccct taggacagaa atagaacact gaatttccct    260520
     acggtcatcg tcgcattggt gggttgagga gaggccggcc ttctgtaaca atgattaggc    260580
     ctacagatta ttcacatatt accgatggct gattgacttt ttaggctcac gaagcatgag    260640
     aagatacaga ggaatttagc aagattcagt ccaaagaaat gacgattaat aaactcaact    260700
     tctatgtata gccacttgca aggattgaaa ccacatagca gcgatatgag caccaagtta    260760
     cgtcgaaaca agtatttcgt actatctata tggttattta ttcgtactaa aatgtctctc    260820
     taactgctaa agacaggcac gttaccgtag ttgtacaacg gaagccggaa tacatgggag    260880
     aacgacccgt cttggacata ctgcatttgg tatcgctaat cacggcgaag ctgtgctact    260940
     tgttaagaag ctcctgagaa acgtcatcgc aagagccttt atcattagcg ggagatcacg    261000
     ggtttttggc cgattcggtt tggatattaa tagtaccgaa agggcgttca tttttgcgaa    261060
     tattaataat cgtaaacttg gtaattccaa tttgtgcggc catctgagac atgttaaagg    261120
     attggttttg taacataaag cttcggagtg gggagttttc tgcctgatgt tggctacgga    261180
     aatttagcac aggcgagtgg tggcagggga agtttacctc aacatgggat gaggcgtaca    261240
     ccaacagtat agcactttca tataagatac aactaccatt tctgaacctt cagaaatcgg    261300
     taggaaggcg gggtctttgt cacctatcca atcagaatta acggcactag gatatatttt    261360
     ccgggaatca attcacaaga gtgcggaggt ataccttgtt gtagctcaga ggtatgattt    261420
     tgattattta ttctagaggg aaacacgagc ttatatatac aacgagaaga tcaagttgat    261480
     ttccaatcag cttgatgctt cgtatagata actcgggatt aattccgatg gcgcggcttg    261540
     gttcctggtc tgcaccagcc tcatatcgca acaacctcag cttggtcgca tgagacaagg    261600
     gtaggaatat gatagaaata tggcgaccat attcttacgt caaacaaatt ctcccaagac    261660
     aaagagattc aggccatatg ccaaatgcga accttgcttg ggatggataa gctcgatcta    261720
     ttgtggcaga acgctttgcc gtcgtggtct ctttccggtg caagcatcct atatttcgca    261780
     acagacccag ggatactccc tcgggagcgg ataaatatga tacatgcagt cccaccctag    261840
     aataactcat acattatctt ggatattgcc atattcaggc agagcccatt ttagcatcca    261900
     ttctgaatcg agaatttgct tagtagtagg gcgattctca ggtctgaatg agagcatcgg    261960
     ccgtagcatg tcgaagaaag cttccctctc ccttgcatca aacggcggta tgtcactctc    262020
     tcgcctaggc tgttgcacgc tatccttaaa ccgatcgtcc caagatcgga aagggttgcg    262080
     gttcattggc ttaccatcct cagtaaattt cagtcgtcgc gcgtcccacc tcctccacca    262140
     ttcaagcggc aaaacaccaa gagtatcgac atgctcgcag gtcatgtcgt cctccgtcgc    262200
     gagaaaccct tcaaataatg gccgttgggc tatgatagac catatggtac aggcgagagt    262260
     ccaaatatcc gatgaaaaag acagagggtc atttgcctca aaccgcgcct cggggggacg    262320
     aatgacaagg ggggtgcgag attcgtattt ccgttctttt gagggggaga aggcttcacc    262380
     aaagtctgta agcaagatcc tggtctctga aagtgtgatt ctctcactcg cttcccctaa    262440
     ccatatgggc gcaatgccgt gggatgggac accaggcaga agcggattgc catctagacg    262500
     aacaactggt tctaattctg gtgctccata tttctcatat aattgtttaa gtgggagctg    262560
     gtcaaaattg ggtggaactt tgagaagaat atgtcaatgg tcgcccagct gtggcagagt    262620
     ggctgcacac taacgaatgc tttggtaaga taaaagagtc tttgaagagc gtagaagtgt    262680
     gacaaaactg caagagaatg ttggattcta ccgagattgg gattttggtc cgcagccttt    262740
     cggtaccaat atcgcgatat gcctgccaga tgtttccgat gctgtctttg cgcagccata    262800
     tgatatcgtg tcacatcacc cagctgctca tataatatca ccccaagagc tggatcgaac    262860
     tctaagaatc ggttcagcgt tgatgagacg tggtaaatga aatggagcat ggggcccaaa    262920
     gatcctggaa ggttttggtg cagaagctct aagggtgaat atattccata acgccacatt    262980
     ctgttaaaca tggcatagtc gtaaggaaca tctctgatag cagctctagc agatggcatc    263040
     tgggacatgg agaagaagtg ttcatgctct tgaagcaaat gcttgtgtat ggcgagaagg    263100
     gcttgccatc tgtggaaagg tatgtggatt ttggattgcg gttgtttctt gtcaaaccaa    263160
     atacactttt cttcccacaa tataagcttt gtgtattgct gtctgagagt agctatatcg    263220
     gcctttgttt ggtcgatact tccagtgacc ccctcatttc gagatgtcga tggtagcaag    263280
     cgtgaagtca tttggcaggg ctgtcgggtt ttcgttaagc tggctcagaa tcagacccgc    263340
     tatggcccta gatgtgactg ttctttacgc ttaaggggaa attggacgtg aatctccgtt    263400
     ctgaaagcat gttagatagt tcctgctacc ccggcttttc agcaagacga gaagttgtac    263460
     caaaagacta accgcttctg tatattgtga taaaatgtcg atgtaaattt ggttgataga    263520
     atggaaaatg gaagaggtag gtctcgatta aatagacgaa gaaaaggaaa ttcagtccag    263580
     tcagccagcc ggtgaagccc gggctatacc acagcctgct gtgccaagat tctcgatcct    263640
     tccaggggta gtgctctatg aggctctaga tcccaggagc tacaatacaa gcgtgataca    263700
     cagagccagg ccctgtgtgg gcctttggta aaacggtaat ttaccgttgc ttcggggtca    263760
     gccctgagaa ccgattgaat cgagcaaaaa ggcctatgtg gacataggca ccgccctgct    263820
     gccattttag tggtgacgtt tccagtgtgc ttgtagatgt cacctgtcac ccgatttgct    263880
     ccattaggca tgattgacac aaggtcatgt ctcatggagg aaggtgtgat acgatgaaca    263940
     acctgatgat tggtgacatt cttctggagc tgaataccgg agatttgcac ctgtaggtcc    264000
     acaccacacc gaaaacaaga tcaacaaaac gatttcctag gtgtaggact ttgatctaca    264060
     ccgatgtggt tgttccagct gatctcaagt tcctgatttg agccttcgca ttgcctgcat    264120
     ctttggcgta cagaaggtgt cccattttgg tggaagaaca atttacaaca tgcccaagca    264180
     gtaggtttac aaccttcata gtcggagtcc tggatacgca aggagcacta gacatagagg    264240
     gtgcgctttc tttcaccttc cagactctgc ctcacgtctt cgttggtact aaggctatgg    264300
     gcagagtatg gtaaattaga ccgcacattc acctggggtg ggcggagcac ggcttggcca    264360
     tcatttgcca ccggccctcg atactcacga ggcggtggat tccaacctga gtccctacgc    264420
     tatcaaccaa tggctagcac tttcccctgc aggccaattc aatcacagtg tcagtacggt    264480
     gcatccgcgg aagatcaggg ggaacagtac tgggacctga ggacggggcg gtgcagttac    264540
     agggggaagc cgggacattc cctctagggt atggttcaga tttcataccc cagaatgcta    264600
     ataaaacacc gggcacacgg tgaaacttta aaatatctgt tcaatacggc gatccggcca    264660
     actctaagcg gactttttca catcagtaca ggtgttcgaa aagaccgata tcttaataat    264720
     agtctcgttg tggatataat atgtcgggcc tacgggtgac gagaatgatt ggtcaagagg    264780
     agctacttcc catatccagg gctccgatac gttcttgaag acagttgttc tctatgaatt    264840
     ttagcacgcg ccaggtcaca acggaagatc caggttccat acctttggga taccgaaaca    264900
     ttagtggaat cgtaaaatat acatggcagg tggagaatcc ggaagattgg ccgaaagata    264960
     gaaagtccac tccagcatgg gcaaacagaa caccaagatg gaattaagat ttgagctgta    265020
     atcgcggtat gaatagggca gcactattgt gtcatttgta accaagggtt atgcgctagt    265080
     cagatgcgct gacattgaaa ttccagccga gcgcctaaag ctcaggttaa attcctgcgg    265140
     cgcggtctca cctatactat ttccagagag ctttcctctc agccagctga tttcaggcac    265200
     gcgtcgtcgc tcattcccag caaccatcat gccaccagct accgcggaaa cgcttctggc    265260
     agatttatca ccacaactgg atatgttcat tcgctttctc aaggccgact taacctcaac    265320
     catcttacag ggtgacttgg aacgaggagg aactcggcga gccactgagc ccttggccac    265380
     aggaaagaac actcagtgct ggatacagcg actccaagaa gttcaccagt ggaccaacct    265440
     agctttgtgg gagcgggact ggctacagcg gactggaagg aatgaaccta ctccatgttc    265500
     agggtcccat cgcttcggaa ccatggctcc gtttatccaa gaagaaggat tgcctgacaa    265560
     tcacaacacc aaaaaagcac tccaacatgg acgcaggctg atgcggtttg aacgtgaatt    265620
     tggacatgga attacgctcc ttttgttacc cgtcctttcc gccttccgtt ccctgtccat    265680
     tggtgaagaa gctcgaacaa tggagatgct gcggagcagt gactttgcat acgtcactcg    265740
     ttaggcgcaa cttctaactt gcctcagggt caactaccaa tacattcatg gactttatcc    265800
     cggtaagcta acacgaccaa cctgcctata ttctctacct aaagtcttcc ccacagaaat    265860
     acactgctca tcacgtgcag aatcaccaag caacccgagg gttcccacta gatcctcata    265920
     aaggcaaagg cttcccgcgc tgacggatcc atcccccacg gttctttgga aaatccttgc    265980
     cacacaagat attcaccagc gggcagtgaa atctccatct taagtgcacc tcgcacgaaa    266040
     agtacctcgt tcgatcgcaa atagaacgat atcggcgttc ctctttcctg cgcgaattcg    266100
     gtgctcgaca agtggtgtga gaccgggtag agcttcagga ttgccactct gtcctccagg    266160
     ttatctgaga gggttcggaa aactgagact ccgtttcgga ctggatgggc ggcattgatt    266220
     ccccagttgg ttggaaaatc gggagagtgg acgatgactg ggccttggtg gagaagaaaa    266280
     gcgggccttc cgatcacttc ttcgatcttc ctggtgaatt tccataattt tagttctata    266340
     tatcgaccac tgtattgaaa gacatacgtc atgatcctgg attccgaatc tcaagaaact    266400
     ttggcatgca tcatgatccc ctcttccata cgtgacagtc tctgacactt cgtttggccg    266460
     cgaccggaga gatctttcca cctctctgac catactctca ggcggcgagc tggcttggag    266520
     tttgctgtaa cccataacct ccatggccga gtatgggatg gtgtgatcga acgacatgtc    266580
     ttgggtggat gtcatattgc ggagaaatag agactaacca aatgaagcct agttccaatt    266640
     tggcagcagg tgtcttgctc tcactgtaag gaaaggagat ggattttgca tatatcacct    266700
     ttaaatgttg gggaaatgtg gtctttcata ctgccgcgac tcagcagcca gtctatggcg    266760
     tgggccgcac tagccttcca tgggaagatg ggaacgcaac tacgcatggc ggaataccac    266820
     attcttcggg tactatcgaa ctaaaacgta aatattgagt gatgcaggcc taaaaagacg    266880
     gttagctcga aattttagct cgcagctttt cggctacgac cattggagga tccacccatt    266940
     cggcccatta cgaaaccgtt ccattctaat caatgcatgc gactccggac attctataca    267000
     aagcgataca caagtttgcg atacacaagt ttcaagggta ggctttacca gatcgaaggt    267060
     tgatggcttc gaaagcaagc gaaatactga gtggtttata aagaaagcaa taaatgggtc    267120
     ttctatatta cactaagata ttgaatattt caactaggac aaactcaaaa aggcctattc    267180
     acccgtaatt tcaaccagat caagtaccgt cccctcgtcc caagtgttcc gcatggaatc    267240
     ctgaagtgaa gttagatatg catgctcgag aaatagcttt ggatgaccga gacatacatt    267300
     gattttcaat aacaaacgct cctcttgtag agaatatgct gcggtccgag gatgcagaaa    267360
     atatttccaa cgtacgtttc agtatagacc tgacctcttg gtattggtca ttttcctgta    267420
     gccctgcacg acttctgatg agagtatatg ctgactgctc agcatagtaa cttccgacac    267480
     ctcgaatata ccatccatag gatttggact gcatgtcctc agccaaaagg ttgaaacact    267540
     gtaatgaggc ctttgcaaag gcaatgcact tcaactgaga tattcttgtc ccaggtgcga    267600
     tgtccccatt taggtatcgc tggagatcag gcaggaagag aagatgaagc agatagttga    267660
     tatagcagtg cagtataccc tggctccctg ggtgagatcc aagctgcgag tcagattcac    267720
     tgaacttggt gtaaatctcg ctgcacagtt tctctatgcg gaataactca gcctcaagct    267780
     cagcgaggct ccattctgac attaaaccca cgctctgcgc tcacgcagat tttgtctgat    267840
     atttccaaaa gttgcaaatt caggattgtg aaagtcatct gcgtggtagg ggatcctttg    267900
     acacgtattg gtaggtgtgg tcttccagta gacttgtaga tatcagctcg tcgctctata    267960
     ccttgtgtga tatcccggtt gcggtagcag tcgtgcactt gggcattgag aagnaaaagc    268020
     attntcaggc caatcgaaag ctgtcgatat tcctcgcaga ccatgggctc gacaacacat    268080
     tgcgtggtat cgatatggca tttggtagaa cctgccgtat gataagccag ttggaggcta    268140
     ctaaatacat cggctccacg gtgtgtgcga ccatagatta tgagtatgat tgctttcagt    268200
     gaagtgggtg atggttcaaa cggtgggtcg ttggtcaaca aacagtccca ggcggctttc    268260
     tcgtacaacg tcgacagacg gtcagaacaa cagcccntct cgggatcttc ttctgcacgg    268320
     caagatagtg ccaggactgc aaaaagcagg gatagccagg atttaggcgt gacattagga    268380
     ttgcggcaga atacctcgta ctcagctttg aagctggtgg cattgatgac acaaaatagc    268440
     taccttgttg ttagtaatcg accttaaaat gtttggtaga ccaactttac cgtggaaata    268500
     gattcaaagt atctttctat taagcaatcg atcatctgac agtttgggag gacatcaagt    268560
     agttccccat gtgaagagca gcctatcaat gaagctggat gagccccctt gtctgaatca    268620
     ctgccatcca gacttgggct tttgctcaag tctgacaggg gattcccatt gctgatggtg    268680
     gaaagcgtct cactacagat gagtgatttc ttgcgacata cttgtctcgt gtcgagagca    268740
     gtaagcgtgt tgggtgacgg ccaattctcg ggcctttcgt cgggggtgct ctccggttgt    268800
     tggattgcct cctccataac agcatttcga gatgactcgc tattgccatt ggattggcct    268860
     tgaattgtat gcattctcgt gtcttcgggg tcgtcttttg tcgtttcaat aaactcgcac    268920
     gtactttcaa ccccacgact agtacatgtt ccacaaggag gccctccgcc agtgcaacga    268980
     attttccgta agcggcccgg caggcaggcc catgtgcgtc tttttcttgg acgaacctcc    269040
     ttgtgagatt tcagatcaaa tgcgcagact tctcttccct ccgcaacgca gttctcgcaa    269100
     ggtggtcccc cattgcaaag agctttttcc atgcagcatg ggaggcatgc gtcgcggaca    269160
     ggccttggct ccgntgcaac aagtttcttg ctggacggag tgtatacaaa ttcacaattt    269220
     tcctttctaa gtcgaataca gttgtcacag ggaggtccac caatgcagcg agttctggtt    269280
     ttgcgacaag actggcatgc tgtacgagcg cgagttcgca cggcagactc agattgatgg    269340
     tttggaggca tcgaggaaag caaagacgat ggaatgaatt aagaaggatt acccaggtcc    269400
     cagggtctgt acaattttgg gtcttattat tttcgacggc agaggctggt aataagtatt    269460
     ctcagcactt tctcccgacc ggagcttgca tttcatcatt gccttggtgg aggagggccc    269520
     agattcttgg gcccgcttgt accgtatgtg ttattatacg tccaaggcat tctttggtca    269580
     atccgtgtca ttgtatccaa gagattttca tgttgagtac atacaccttt tgctagatcc    269640
     attcactcat ctcagtcgag ttatnctttt tctagctaga agagggccga gcgttttcca    269700
     atagatatca cactagacta cctctgttta gttgtgcaag gatcgtcata tactaatgan    269760
     ataatacant actnatacta acccaatgcg agatctgcgc ataccgatca ccatctggtc    269820
     ctttagggct caggccaagg ttgcacggac taatttcata gtaaactaga ctcagctctg    269880
     tgaccgcttc atctattttg tgcccttggc ctctcattgt agtaaatatc gcacggaaat    269940
     tcggtcaagc ttgacacatt taaatggtat tatttacaac cagaacactt ttcgtcacct    270000
     gtacctcccc gccgaacatt cgcattgtgt cggatatttc cattccactt ataacagtcc    270060
     cttcgcgggt agaaccccat tgctgtattt ttctattcgc aatttcataa gccagatgaa    270120
     atttccagtc tactcctaga cgtgcctgga tttgtcagnt atgaaaaatt atcatcaagg    270180
     cttcgtacct gttggttttg aagccaatcc aatgtacatc tggccataat aaacagagtg    270240
     cttcggtcca tgtttgtctc gctgggatac agtatggtct tggtcnggga ggcaaggtgt    270300
     aaggnctgcc gagcgacagg actgcaactt atatgttact cttcattaac aatcgcaggt    270360
     attgtaacca aaagcccgag gtaaacatac atagaacaag nctnttcgga tgtgncgaca    270420
     agttattggt tttcgactcc tggtcatacg cgatagaagt catgcgaatg tggtaaattt    270480
     tggtgtactt atatnacctc ggacagaaaa accacgacgc gcagcactgg gcgtttctcc    270540
     aagaacaaga ttccagcatg caggtacttg cataccttcc tcttgttagg caagtctgga    270600
     ttgcccacta ctaaagctct aggctcgtta aatgggctac cgtcgtaaat cgagaccaag    270660
     agtgtctggt tgaattatga attgctggga gaggtagatt ttgtaggatt ttgaatgtga    270720
     ttggtgatat ttagccaaan gaaagcttag acaacataat tacgcatacc atagaacaga    270780
     ttattcagcc ctcaactgga tacccctttg cctttctcga acagtagagc agtgttttag    270840
     tatttgtcgc cccaagtgac aaagttgttg gggtacaaat taagaaagtg aagggtgtca    270900
     tcgggggccc aatttacaaa aagcacaaat tgtgacctag atatgaaaca aaagaatgca    270960
     tgcaatcact cgagaggctc gaaggngttt gcgaagcttc gttcncacat ggtgtttacc    271020
     agcntcatgg ttatgacaat cacaancaac atgacccgtt gcccacaaat ggcgaagtcg    271080
     aggaccaaac gtcgaaaaag cttccaattt ccgatcaaac ccgccttgat gatttgaagg    271140
     agtagtttgg ccttgagttg gagcgtgtat cgggtcncct ggttctccgc cagccaaatc    271200
     attatccgac caggtgtcgt catttccagc attgagaatg naaccaaagc ggaagtattc    271260
     ccgtaaaaga caggncatag atgcagtgtt cctttttggg ttttactgcc aactcgcaag    271320
     ccgtcngctc cggatagagg cctccactcc gggttcctcc aatgctgcag ggtgtgacgg    271380
     attatgcacc aaaaatatcc tccatggtca agcagaaatg cgcacccaga tatcgaactt    271440
     ttcatctcgt cgagggagat ttctagcttc catcccgttg ctcctatttc cagtaattgg    271500
     tcatcttggt catctcgcgg ccggatgtgc aagatgttcc atggctgatt aaatggttag    271560
     taaattcctt gcgtgggaaa gaaagctcac ttctgatttc aagaccatga gataagtaat    271620
     tgctgcagat aggtatgcct ccatcttgtg agtactagga tagtttaact cataaactag    271680
     aaaatgactt gcgacacatg gaatgcaatc atctcgtgag aatagaagca tatatatcct    271740
     gcttgtcgtg tttagaaata ctagaggtcc aggtgaattg tcatttccat atttacatgg    271800
     accccatacg cacgccgcat cacacgtggt attgtgtctg cccgatccat attatctatt    271860
     tcattgacag attaggttta aaatcaaact agaacttttt gcaattgcca aaaaaattgt    271920
     atgtatatga cctcctgaaa caaaacgatc tattcaagga tattgcatct gggaggaccc    271980
     tggtctctga atatacatcg ctacccacaa attaaatgaa gaagtgtata gttatttaat    272040
     acggtcgaag taccgtgacg gggtggaatt gttatcagta aatgctgcat tttttctttg    272100
     gggctttaaa atattacaat caagactaag taaacgtttg aagtcgtcag tccggggtta    272160
     attggagctc ttggaatcgc agaccgtatc tcggatccca aaattgtttt cttatagtcg    272220
     caaaatagta attaccggtc ggtcaactgc tggccgtttt ccagtggggg cttgaggcac    272280
     tttaacgtgc ataaaggggc tgaacgctga tctctactca tatcgcccgt ttaggnnnnn    272340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    272400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnaaacg ggcgatatgt ccttatatga    272460
     gtagngatcg gcggtgcggg ggttttggat ggttcgcaag gcagctacag accatgttag    272520
     tcaaagggtc gaggcncttt ccgatttaac tggttggggc cagaatgcca tacgccaatc    272580
     ataagcgagg attagccatg gccngtgcct acatcaaatg cagattggct ggctatgccc    272640
     atgataataa tccctgtaac aagacgcggt agggcgacgt aaaggcagac tgtgagtacg    272700
     cctttctttg gtatatcccg tttcccactt ccgcaccaat tctccttccg cacttctacc    272760
     tctcaataat catgggcatc actgaaagca agcaggtcgc acaggctatc tatgtagcct    272820
     gcaccgaggc tgagaaacga ggcagcaata gcattgagcc tgtgctcact gacaatgtta    272880
     gtacgccgct cgtttatcta ttattgaggg tttgtcatga caattttcaa gcagtttctc    272940
     ggcttgcttc acggcctttg gtccaaactc cctgacactg ccaaacaaaa gtttgagcct    273000
     cgcaatgaga acgcccaaag acagattgcc cctcaccatg agaacgccca aatacagatc    273060
     gcccctcacc atgagaacgc ccaaagacag attactcccc gccaagagaa cgcccaaata    273120
     cagatcgccc ctcaacatga gaacaccata acagccagcc cgagcatgac cgcaagaagg    273180
     aaaagcgtcg ataacaggca tgaaggcaag cgtttaccga agaaacagaa gaacaacgat    273240
     tctggaggtg gattgctctt atatgtacta aagaatgcgt ccgtctggaa gcgaaatcca    273300
     ttgtcattct tcaatgaacg cggaagcaaa cttgatttgg agagctctcc cctggatgga    273360
     atgtctgact atatgacgac tttgggcaat cgtatgggga tagatcaggt tcggcagcgt    273420
     cttctcaaag tgatgcattt tcgtctgtca aaatggcacg tctggaatga gtcnacccaa    273480
     gatggtagga aaagaaagcg tggacaatgg gctcttgaag gcaagaagtt cgacaatgtg    273540
     tgtcggacnc ttgggtgcgc gaccacaagt gagagtcagg atnggtactt tcaccttggg    273600
     aatctctttt attcactcct cggcatcaat gatactttgt aagtgcnttt tttctttttt    273660
     gggtgngggt ggggnggagg ggaactctta ggctaataag tccaagtgtg tttaggaaga    273720
     taccaataga cgctgatcct gaatccccgc atcttaagga actccgacaa tgccgtcttg    273780
     tcacccgcga nagtcagaaa gttatagacg agttagctga ctcgattttt aatgctatat    273840
     gggagtcatg taatcgtgtc tcttatgctc tccctccgcc tatttcacag tctcctcggc    273900
     cattcgatca gaacttggac gatcaggcct ctcgaccttc agactctttc cctgtgtcca    273960
     ccaccgagcc tcctctgcca ttcaacccgg gtttcgctca aggattcgan caaaattttc    274020
     tcgatttttc tgatcagaat ttaaatatcg tcggcctcaa tcagcctctt gcggagacct    274080
     ttgttccggg ccacgctcag gggttttatt gggccccctt tccggactnt aatacaaaca    274140
     tagatgatct cgatttgctt catcggcttt ttgaagagca tcaccggtca gatcctgagc    274200
     ggggtcanca agatcatacc caatcctgca atcaagcttt ccgtcttacg ccattggaag    274260
     tagcttcggg cagttccggt tgcgaatcac gtcaatcgaa ctttacggca gagtccgaag    274320
     gncaagcgta tgctggtcct ctactggcta atgatgtctc atattctcct gatttagagg    274380
     agtatcgaat acatcgagct gctaagcatc cccaggaaac gactcaggga ccggataatc    274440
     tcaccgncgg acaaattngt ggtgttagtc ctattcaagt tacaccagaa agcggaattg    274500
     cggcgtgtta gcctttttca taggattttt tttcgctcta tccgactcat taggagcatc    274560
     tttaaaccga tcttattcca aactccgaat actacaataa gccaacctcc atcgatcntg    274620
     ataatcattc aatatctact ataagcgcca ctaatttagc ggcttgcgac acttcaacat    274680
     cgcatttccc agaaacttga taaaaatggt ccatgtcaat agccaaccca gcgatagatg    274740
     tttcgccttc cataaacaac ggtataacca atgtcagctt tcgccccaca tacgacttcc    274800
     ccgggaaaaa aacaaagcct ccggtcttat aaatcgatgt ttcagcacgc tgtattaata    274860
     tattagtcgt gaacttagaa tattccacgc ggtgataatc tttaccgtca gctctgacac    274920
     cgcggcatta ataggggccg cgcaagcatc tgttgggaaa aaaggagcga gtgccgagat    274980
     tttaggcttt ggtaggcctt gagcataacg ttgcacttct ggccaagctt gagtcgcgca    275040
     ggccttgacc ttgtccgatg ataacgaaat gcaggatggg gcaccctgtg acattgaggt    275100
     aatgacgcgt ggtaaaggtc gatttaaggt cgcagatcca aattcgnggg ttttcgattg    275160
     acagagtgtg cttcggatta atcaagtatt gtagtcgtag gtgtgttggg ttgttacgaa    275220
     aaggaaactt tgatgagggg tcggtcgaca gcggggctat aaaatcgaag tagtctcgtg    275280
     actttctgtc tgacttgggc aggtacggta gcttacgtct gtcaggctat acggtttcga    275340
     aaagttatcg gaataacatt tttccataaa gaatatngga tatcttgatg actaaatgtc    275400
     cttccttccg tcattcatta agccgacgaa acaccttcga gaaccagcac tttttctccg    275460
     tctggtgtca tggcagcaat ccaacagcta agcgaatcga catatacatt tcttagtatt    275520
     atcgatcaca cgttagatga tattgaaagt ctctgtcgtc tagataacgg ccatgatcga    275580
     cgcgttccgt gttacggact tggatcgttg gaaattgtgc ctctagaagt ccttcaaatg    275640
     atcattctac ggcttgatat tcagtcaata actcatttcc gacgcgtcaa cagacgagca    275700
     gggctggtcg tagatcaggt cccacaatac aaacaaatca ttgtgcacgc gccagcctcg    275760
     attcgaggtt gtctcagcat cagaactgga ttttcttttt catgtcaaga tctatacgat    275820
     aagctgcgta caactaattg tgacagctgt ggtgactttg gtggttacct atacctagtc    275880
     acatgtcgtc gcgtttgttt tctctgtttt accgagaaga ccgactacct gccactccta    275940
     cgaagcgacg tgatccggaa atttggactt cgccccaaat atctagcaaa actcccttct    276000
     ttcaaaagtg ttcctggtcg ctattcatct cgaggaattc aatgtcgccg tcgaattact    276060
     ttgattgatc attctgctgc acgtgaggca ggaatcgttg tgcacgggga cagcaattca    276120
     atgaagcaat acgtatcaga gagtcttacc aagaatctcg aaatacacaa atctcgaaat    276180
     tcgacatcta ctggagcgaa accgcgactg ccannnnnnn nnnnnnnnnn nnnnnnnnnn    276240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    276300
     nnnnnnnnnn nnnatttgat ttattaatgt agtggaaact gttatcgatt aactgaaaat    276360
     caacggtagc cgtgacagca atccctcaac tacccccttg gccctcacaa aaatatggta    276420
     gaagtgtgcc tgtcagtaag cgacaactac aactaccgag tactttgtta accagttagt    276480
     tggttaatgc aaaggaggcc tcgtaacaac tcgacattag cgtctgagaa ggtataccag    276540
     agggtatgcc acgtaagggg gaggctatta cacttgggta ttagctattt cgagaattac    276600
     taggattttt tggtgcgggt agaataatgg cgggaaatgg cggtgactga gggataacag    276660
     acacggtgct gcctacttcg gtctagtggc actctcagcg agagtaagag atacgcttac    276720
     ggctttttga ccatctccaa aacacattga aatactagca gtacgttgtt gtgtattgag    276780
     ccagggcagt gacgtcgctc aaccttacag gtgggtacca gtgggattaa gtggagattg    276840
     gggctgccaa taaaccatat gcccccaaga atgcaagggc tttaaattag acgcgactga    276900
     gcggtcttca ggaccgccaa tcctacaatg actgctgtgg tggagagtat atcaccgcaa    276960
     agacagcgag tccgcacttt ttttcatgtt ccttaccacc aagcggtgcg ggaaatggga    277020
     agtccgagat tttacccaac gtatgcatac ttagcaacgg atagacccag cctcctgttt    277080
     ttggaaggag agaatacggc caaggctgtc caccaacgcc agattatgct tcacttagcc    277140
     caattactgc ggagctagaa aatcgttgaa ttgttcacaa ggttgtttga aatagaatct    277200
     ataatgagtg aagatgttaa agtggatcca ttttacgtgc cgaacggatg cagttttata    277260
     aattggtggg ccaggtatgt gatataaaac tatcggaaga ttgaaacaca gcatgtgagg    277320
     ctaatagtcg tcgaagagta gtacaagacc cctagttgtg aaagcataag ggtcaacggc    277380
     cagcaaacct gcagctgttg ttgaactatt aattgtctaa aaaggtgctg tataaaagtg    277440
     atcgcatacc tcatacgttg gaactcaatg tcatatagta aggtagagca attacttata    277500
     ctcggcgaag agcgtgggaa tcatgctgcg ctctgggctg gaagaaattg caaattgcgg    277560
     gttgataaag gagaaagtga tctgccgctg aaatgaggaa tataaaacgc cgcagcaagg    277620
     aaagctgaac attgattgta taggccatga cgcacgcaga attggacata taagctccgc    277680
     acagaaaata tgaaattctt cggacaaaca aggttaattc tcgataagcc gtttcacgta    277740
     ctcacggcga agattttgga cgaaaatcac tactgcaacg cccacgttaa ttgtctcttt    277800
     tcttctcgac tgatccttcc tcttccgaac ttagctgctc cggatgagtt tgtggccgac    277860
     aacgctttcc cgcacccggc cgtagtcgat tggtaaggcc ttgctggagt gtctgcactc    277920
     gctgttcttc ttcagagcgt gagagaaagt cacatggctg tctccatgtt atcaaagaat    277980
     tctcgatcga gcccctagta ctctcgcgag aggtcctcgg tcgcgaagtc tcttaatgac    278040
     agccgaagtg tcgttgcctc agccggaagt cctgaatatg tccgaaatgg ctataactgt    278100
     tagcatctaa ctttcaannn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    278160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnaag    278220
     cataagggtc aacggccagc aaacctgcag ctgttgttga actattaatt gtctaaaaag    278280
     gtgctgtata aaagtgatcg catacctcat acgttggaac tcaatgtcat atagtaaggt    278340
     agagcaattc tttatactcg gcgaagagcg tggaaatcat gctgcgctct gggctggaag    278400
     aaattgcaaa ttgcgggttg ataaaggaga aagcgatctg ccgctgaaat gaggaatata    278460
     aaacgccgca gcaaggaaag ctgaacattg attgtatagg ccatgacgca cgcagattga    278520
     acatataagc tccgcacaga aaatatgaaa ttcttcggac aaacaaggtt aattctcgat    278580
     aagccgtttc acgtactcac ggcgaagatt ttggacgaaa atcactactg caacgcccac    278640
     gttaattgtc tcttttcttc tcgactgatc cttccncttc cgaacttagc tgctccggan    278700
     gagtttgtgg ccgacaacgc tttcccgcac ccggccgtag tcgattggta angccttgct    278760
     ggagtgtctg cactcgctgt tcttcttcng agcgtgagag aaagtcacat ggctgtctcc    278820
     atgttatcaa agaattctcg atcgagcccc tagtactctc gcgagaggtc ctcggtcgcg    278880
     aagtctctta atgacagccg aagtgtcgtt gcctcagccg gaagtcctga atatgtccga    278940
     aatggctata actgttagca tctaactttc aagaagactg ccgctggaan ggaatgtacc    279000
     agcgcgtcga ccacagcggt tgcntgaagc tcctctatgc catccacggt tgcatattcc    279060
     ggtcaccata cggtaatggt tgcttgcttt gaccgtttat aatcaacatt gaaggcaatc    279120
     acagcattca cgcttccatc aatattcagg atgtactcgt cgtccgctaa gtgtgaaacg    279180
     tgttgacttt tttgtgaata gcacacctct ataataacac cggggcagcg tgctcgccgg    279240
     tgcttaaatg atgcacccgg ctccccttta gaataagtct gctttccatc tcttagttca    279300
     tcggatatca tgattcggga agtggctagg tgctcgacct cattcgcaaa accagcagag    279360
     ggatcttcgc ttcattggaa ctgcttcatt gtcgtgaaac cgactatctt tgcacaaaaa    279420
     acatcatgga gaggacttgg cattcggata gttaggcagg aacgacaagg gtcgtagtcg    279480
     tacctatgat atagctgaac aaatgtccta ggatagcgac gcttgccaat actcacctaa    279540
     ctatgtcttc aacgtattct cgcagagaat cctcaccatc tagcatatgt gaagtttccg    279600
     tataatcgtt caaactgtgg cctatgacct gcccgatgga gcttaagata gtttagcaca    279660
     cgttgagcag ctctcaacaa cgccttttct ttcgtaagcg gcggcgtcag aggaggctca    279720
     aggaaactcc ttggtggagt aacttcactt gccatgagag gtgtaccatg tcctcaagat    279780
     atggggttgt ttatgccgca gagggggcaa tgagccggta tcacgtgttg ataagataga    279840
     cagatattgt gcaacatggg cccgccgtac tcaagatatg caaagatcaa gcgatgtacg    279900
     tacagtaaaa tcgcagctgg gagaactagc agcggcttag ctctattagg cctccagctt    279960
     ctgccttacc taaactgggg cccatgattc taggtccaaa gaagagtccg gcgcccgaac    280020
     catgaaagta accaatcagc agagctctcg cgtagatgtg caagatgccg agagataatt    280080
     gtttcagtgc ctgcggtcat atccaatgac acatcaccgt cgcctcgcaa agcggcctaa    280140
     gcggccaatg tgctggccca gaggattctc gccccatccc gacacccacg cacccttagc    280200
     acaccctctc tattctttgc gacttgcgaa gtcaaagtgg tcacttcagg cggcgattta    280260
     agtcactcga cctcactcta tttcagctct tatatcccag agagcgcaag gaccaaagta    280320
     gttttgctga gagctggaca agcaagcaat caagaatacc cggtcggctc ctactatgcc    280380
     tcggcaacga cgaatcatat ttcaaccaat ctcccggatc gaagtgacgg caattgcctt    280440
     ttgggaagtg gtgtcccaag ttaatgcaat caaccacgtt ctacagataa gagaacacgg    280500
     ttgaaacccg attgaagccc gattgggttc tagcagtgcc atctgaaacg aatttccgtt    280560
     gggtgatatc cctgcaggag tgctagttcg ctcgtagtca tagtagacac ttcggccatc    280620
     cttccaaaag caaacatcac atgagcgttg attgatggtg gaaattttgc tctgggacct    280680
     aggggctagc ccaagaggtc ccaaaaccat tctgattcga tgttgtttcg gacaccaaaa    280740
     ttttcaaagt ggctgcctgt tcgaacagtg acatgcccac gcatcctccg cagcgcggtc    280800
     agctcgacga atatataatt tatcttcaaa aaacagtcga ggtagggaat gtagagaatc    280860
     cagcttgcct gacaagtgcg tgatatgtta ggagacgata tgaacggatg aaggatacgc    280920
     ggtcaacttg actaacttgc agctgcagcg acatccaggg taaatggtct ttgcacatag    280980
     tgcttcggct tgcatagaaa atgcgtgcat aagaaccaac tgggtacacc acaacacttt    281040
     tgacagccct catgatgcag cttcctgtat gcccgaggtg attcttgggc agtgagctct    281100
     cattggctcg cccgtgcccc ggtcttaccc cctcggtttg tacctgagat gaccaatgtt    281160
     aaattgtagg ctaagaatga gaagactttg cgtctccttc tccttgtagg tggtctggtg    281220
     ctaatagcct gattgtctgc ggaggtacgc tcatctgcca ggaagcaaga cagagcatca    281280
     gcatttctgt gtcttttgaa tttcaggcct ggaaagacac cagatgtcat ccgaagacaa    281340
     cgaggatcat gcattcgata ccagcagcct acaccacctg aaggtgtttg aaaggttgca    281400
     tgcttagcca caagtatgat tcgggtagcg gtataggctg atcggagttc aggagttgta    281460
     tcatgtagac aaatcgaaca atgacctggt acacagaatc agtagggaga aagaggccga    281520
     ggtacgcgat acgaaacttc tgatgactca tcgtcgatag tagtcatgtg gaagagacag    281580
     agagcatgcg atcgtatgta taggggagct cgagcagaca agatatttgt tcgcgtggca    281640
     ttcgactcga gtgacagaaa tgaggctgtt ctcctgttgt acgatccgag tcagcaagga    281700
     ttgatctagc tggacgagtt gtcgtagcgt atctgttcat ggaaatccca aagtgcgctt    281760
     gggacgggac aaccagtttg cgcaatgatt atatcggctt cacaactaga gcacttacag    281820
     ctctctgcaa tgcagtcacc atccatgcca cgtcgcattc aagctcatcg caatcggctg    281880
     tcacttaaaa agccgcgctg gggtgcacaa cccaatttgt tgagacagta aatgcgcgtg    281940
     acgaaccgac ttgcgataag tatcgcactt tcatgatgga cgaatgtgtc gcgacgtcag    282000
     aggttcagga actccacaat agtgtgaagg cggtggggac gagggcggaa gacgcgatgg    282060
     agcacgctcg acgccccgcc accttagtct aagtctcgat ctgtactcta ggatccagaa    282120
     gtagactcct aggagcccaa caggtcccag atctaaccaa ggtgttccca gagccagttt    282180
     gtattcagtc agggacgtag aggcaagatc ccaggagtag atcttgattt tcctggagat    282240
     ttgtaaaagc cccaggagct aaggtgtatt tcccagggga tatacaactc ccagaaatgc    282300
     ttttgagttt cccagggtca acatattgat tcccagagtc aatataacca gcatcggagt    282360
     ttgccagtgt ccttcgccgg cccgagatgt gttatcttct gccaacagtc tccgtctcga    282420
     cgcgacacgc accactgtga taaatccatg tctactgttc tttggccacc accgttgggt    282480
     atgaatatgg tttcggtcta agaaaatatc ccaaaattaa gcgaaactgc caacagttcg    282540
     tgggggtgca ttgccatcta gtacttgcga agatgaaaag gtcgcgcagt tttagttttg    282600
     gtgctttgcg agtttgaaca tccagaactt catttgtatc atttctaaac ttgctgtaaa    282660
     actccatacc acggctatgc tctatgttgc tgggccgaat gcggtgtgtc tggtcacgtg    282720
     tcttcacgcg tgaaacagtc gcttcgctaa tttctcgttc ccgtcacacc tccactgtaa    282780
     actaagatca ccttcgagtg gaatttagtc gtgctgaccg gcggggtggt gcagacgtag    282840
     aagggcctcg tggtagatga cctcctagcc tagccgagcg acgggggcca ttctccacac    282900
     tctgctcgac tgatctccct tgcggtccca ctgaccgcag ccgcggctga ctccgactcg    282960
     ggttatttgg tgatggatcc ctgatagtgg caagttctct ctcgggagat gattcagttg    283020
     ccgtgtggat atgacgtgtc tcagcatccg acgattggac tcgtagtggg cgaatcaaag    283080
     cgtctaaagg cccttcattt cgactgtatt gatcagcgtc ttggatattg catgattgga    283140
     attagcctta cttaccacac acagcatgac gtcccaaaac ccgtagttcg tttttccagc    283200
     cactcttccg cgcaggccag gtgggaaagc gccttgcact gacaacgcaa tatcacactc    283260
     tcatttgcaa gatcttcatc ctcggcaaga caaaatacac agtggatgtc gtcgacctgg    283320
     tcgctcaggg tgagatcctt gagcgtcaag tcttggacgc cagcccagat gttagcgacc    283380
     gatgtcagga tagctggttg agccggcgaa acatgccatg gaacactgtt tgtccgcagc    283440
     attgcagaag tcacaaatgg attgaatggc tgcactggct cggggttagt tgacagcggc    283500
     accggtgggt cttgtctgag cgcgtgaggt gaccagtcgg tgttgcctga tcccgtcagg    283560
     cgtttcctgg agactgacga catctgacgc tggcccgggt gcgcaataga tggagcggca    283620
     actctagaac catgcggcac tcgcgcctgg ttgcggatgg ctgcttcata ccaccgctgg    283680
     ccaacttggt cggcctgccg ttgacggtgc catctcgcgc agaggaagac tctagcaata    283740
     tcatagagtt ttgactgcaa agttgacaag tcaaacgctc tctggcgaga gtggtcaacc    283800
     tttcatggcc gatcttggtg tcttgaaatc tgacagagtt tttgcacggc tcgccttttt    283860
     ttgtcatccc gcaacaggac acaggaccac cgtgagggat ctcgcagaca gaaatgggtt    283920
     tcaaggaagt acagaagaca ttgggctgat ggcaaagcca gaaaatgatt cgaattggta    283980
     ttgatgttgc gcaatctccg cagcgttccc ccgccagctt tatatgccat catcatggga    284040
     tctatactta catcgcgtca tggctgctga cctggaaatc ttcccttgaa actgtcaaaa    284100
     cgtcgaagga tgcactgcga tgcagtatct accgctatac cgctgatcaa tgggcgcaag    284160
     aaggtgtctc attctggatc actctttgga ttcagtgggc cgtgcattta gaccatgcat    284220
     tcgcggaatg gcatagctgg caaactgcga gtcgcccagg ggcatttgga agagtgtatt    284280
     gtgtcatgat tgctccaaga ccgaaggctc tgaatacgac atgtggtatg ttcgcgctta    284340
     aagtgggtct gccaggctct attgctacac tgctatatga attattcgcc ggtttctcgg    284400
     attttgaggc ccagttataa ggggatagtc gcgtatacat cccagtgaac ccagatgcga    284460
     tgtgagtccc gcatatcgta tctccactca ttgtgtatgc ctcgcgtgga tcccgacaaa    284520
     tgcggctaga gctcccagga aataataacc gctttccagg aacaagatga ggtgtgctgg    284580
     aaacaagcca agtcaaccct cttctgtgcg ggcatgtact ggcgaaagag caagatgaaa    284640
     agcctactat atactttcta aaacttatat atattataat tgccctacat gatcacagat    284700
     acccgctcaa cgacaatatc ttctccaact gattatatgc aaacctggcg attgacccga    284760
     gacgcttata catttacttt ttcatcatgt ccttcaatcc tgctcatcta caatggatat    284820
     tggaccaagt gttgggtgat cccttgcacc gtgagcggtg catatgggca ggggatgacg    284880
     ggaatcattg tcaaaacact gtgccgcttg actcccggat aaatggagta ttgcgcttcc    284940
     agctgcttca gggccctctg ttagtgtatc cactagcgca ggaattttcc tcagctgcaa    285000
     agcagttact ttgctttgag tgcagacgtc atcgctgtcg ggcaaaagtg tgggccaccc    285060
     gatttttgca tctgttggat caagccaaag atgtcacggt tcactcggag cctcatgatt    285120
     cggctctact ggtacatcaa tggccaacca gcatgtccca caatgtcgcc acagccgttt    285180
     accccaatgg gtttttttca aaaccggagg ccacctggtg aagaagccaa actacgacat    285240
     acccctaggt gcatttaggt tggcccgatc catgaatatc gaggatccgg acattctcca    285300
     gacgacaagc ggcttcaatt gtgcagttgt tacatgcatc cggtacaatc tatgcatatc    285360
     acgaatatcg aaagtttgtt actcgtccac gcagtgcggt ctttcaactt ccctcacgaa    285420
     cgagtttcgc acggaatggc cacctgaagg ctctttgttc tcgcacgacg acccgacagg    285480
     ttgcggaact aaaaagagtt tagtttcagt ctgctttgtg aatgttcgcg gtagtgggtc    285540
     caaactgatc gaagtgccgt cgtctcattt tcacaatctg ttagcttcat gtggggacgc    285600
     ctctggggat ggggcggctg atcgccgtgt gcattccacc cgagaagcag tggtaggtat    285660
     ctctagagga ggctctgacc gactgatact gagaaagaat atttgaattc atgaagcttt    285720
     cgcgtaagcc tcttaaatct ggaagaacaa gttttcctca tatctcagtc aacgtggtac    285780
     gtgggaggac ggcagttttg aggagatcat tgggatctgg ggaataacaa taatacccgg    285840
     aggcctattc gaaacaaaat aatatgatag cactcatcga accttttggt gcagtcacca    285900
     agtaggatcg gtagcctaga agaactattg aaatctacat ctggtaggtc cgtatcacaa    285960
     tgcgagaccc gtggttacca acgtcaattg atatcgatat taggctcaaa cgcggtatat    286020
     ctgtttcctt cgttccaaat gatttgcagt caaattagtg tcaggttaag tttcaatgag    286080
     gtctacttga tgtctaacat tcagcgcgtc acaagtacac ttgtaatcta ccttccttag    286140
     gttcggtgac gatttttcaa ggtttagtct tttctccctt ttcggatatc tgtgagtaat    286200
     tcgaggtgag cagctcacga gatcgagcat cagcagttga actaactgtt caccggcttt    286260
     cgaaagtgcg gaaacatcag tagaaataac agcagcctta gcttgactta tcagctatag    286320
     atagccctgg agaacaattt ctgatgcaat ccatctccat gaccaaaatg gacctgtccc    286380
     acttcgcctt tcccaattgg tcggccagcc aagagacaac gccgagtatc ccaagctcca    286440
     gaggatgaat ccaagttgaa aacccatcca cagcaaactt caaacggcac aacgatcgaa    286500
     tccaaggtcg gtcatacccc cctgggcagg aactgaaaaa cccactaata cagaataggt    286560
     tccaatgaga acacggggta acttaccctt acggcggagt tcatgaaagt agtaaacctc    286620
     aatggctccc tcgctacacc agtcctcaag ttgctcgact cgtacttttg cctatgggaa    286680
     tgctacgtcg tcaaatcggc ccagaaaata cgactcgagg aggagcagcg acagcttcaa    286740
     gcgtcaaatg acttgctagc aagcgatagc gatatccttc tacggctctg caatgaacaa    286800
     acttcagtat tgtgggaccg caaacgagcg gttcaggctc tttgtaatgg tgttgtttca    286860
     gccttggaag cgagcgatct tcaggcctac tccgccgagg agcctgagcc ttgataaagt    286920
     ctccatgtgg tagagcgttc atgggcagaa agaatggcat ttgattttcc gctatctatt    286980
     tctcttttct ctaaggagag ttaaggctta tactgctggt gaattttcct tgggttggtg    287040
     acggggccaa acggtgcacg ctgttgatat attcaacgca ttcgataact tagcatgtgg    287100
     ttataaattc ccctagtttg tcctcattct gtgtaataga gaggaataaa aactgcacca    287160
     tctccaactt tccatccctc ccaacccacg ttaaatcgct gctttacaca cttccatatt    287220
     tccctacagc gttcgccggc cagtcatata ccagaaatga acggattgaa caacaatggt    287280
     ctgtacccgt tgccttgata atatcttgcg ctaacattac tagactacga tttggatctc    287340
     gaccttcacg ctatctggca tgaatcttct ggcataccga caccgcctcc ctgtctcgct    287400
     actgatccca atgatctgtg gcaggatttt cttggcagag acgatcctcc agaatacgaa    287460
     actcaagagc cttccttgat agaatgcctt ttctacccca atcctgaaag tctgtccggc    287520
     ttcaagtgga caggtccaga tcctctgtcc aactctactc gggctaacga cattttcctc    287580
     ccacatgtca gcgctccttt tccctaaaga agtgcactgg atagaatttc ggtttgcgcg    287640
     atttgaccgg atatctggtg agactatagg agaggatctg ttcttcctgc cacgggttga    287700
     aacggccatg gggaatctct atcggataag cagacagcta ctagacacaa tcacctggca    287760
     tgctgtccat gcaacaggga ctagcttccg actgtccctt tggcctcgta cggaatctct    287820
     accatattcg agtccctcga cacattatcc gctgactgcg ctgcccccga tgctatccct    287880
     ggacccacga ttttttgtgc ataatatatc cggtaattac aggtgactta tcctgaccaa    287940
     gcgggattac tcgcagacac attgcagtga agacgttgtt aatgaatcaa tgggtatttt    288000
     atgcgttgtt actataaact atcggaaagg atatagctgc tttcaatgcg gcaattctcc    288060
     ctgcactgct tcgccggttg tagtatttct atgtcgccaa gataggatag ggcaactcgg    288120
     aataggtaaa tccttactct tctctttgca acgtcccgca gccctgtcag attggggcgg    288180
     agggggtagt tccagtcatc gagtaggcta atcagtcgtt cccgagatga ttccaacgcc    288240
     tgttcaaaaa agcgcagtcg agctagctgc ttgtcgtggt gaagctgaag cccgtccctc    288300
     tcttttctca ggtgcgtacc agcctccttc aagatctcat tgctctggtc aatctttcgg    288360
     acatcgatgt gtttgggaac gcatgactcc cataggcgtc gatagaatcc aacgagtcgg    288420
     gctgctggga aggcaacctt gggatcgtca cgttcgaggt ctgctagcac cttcaagatg    288480
     gcttgaaaag gctcggtcgc caaagtatgt cttgttactt cttcgtgttg cgaagtcgag    288540
     gtctaggatg gtcagccaaa ggacttgaag ccgaagggtt tcacttacaa tggaaggaca    288600
     tgatcagaag gttccacatt attgtcctta tcactaagga ttggcaattc agtggcctgc    288660
     tgttcttctt tttcctggtc tggcgagctg tttggggact ccagttctgt ccgcaggaga    288720
     aattaaagat ggcagtactg ttcccatcat gccttggtgt ctcttataga atatgcagcc    288780
     gcaggtaact atgcactggg ttttacgatc accgagctag gttggtcaat aaacgcaagc    288840
     agctattgaa ggaatttgtt tttttaattt tagtgagtga ttagtagtaa atctgataaa    288900
     agggaaagtg atcaatgggt tggtggggaa acttataaag cctcactatg ttaagggcca    288960
     gatatgaacg ctcatcgagt gaaacacatt tcaaccgggc atcttcactt tcgttgaaat    289020
     tctcagaaac tcgataaaca gaacattgta aaacttatag tgacccaaaa aagaagccca    289080
     aatcaataaa acgaaaaaaa aaacctgact aatgtctctt cgtcgtcaca agttcgaaaa    289140
     ttgagtgttg acaacgtttg gccaagcttc aacgggtcga cgggatcgag cacccgcaca    289200
     atctaccgtg acctcgcatt ctgccgtcta gacccgacag acccacagct caaaaccaat    289260
     acaacactaa agcgaggcca gtataaagaa ttctatgatt tctcgggatg aaattgtagg    289320
     cgcttttcgg tgattcaacg ttgagtcgct catagatgcg ctgatcaaaa acaagagata    289380
     tgagcatgtc agcggattaa atttctccca caagcctcaa ttagagggcc gtgaaggatt    289440
     caacagtcag ccaacgtttc ttgactgact cagcatccct tttctcaaca ccactcttac    289500
     tactctctct cactgggcat ttaaagtcaa aagcagctgt cgctggaaat aattgcggtg    289560
     aaaaggagac acgggtttca acaggcctca gttaggagtg tccctccacg caagcagagc    289620
     acttgtgaaa caggatgagc cgagaagtct ataaatacgt cttctgcccc cgggcaattt    289680
     gctctacaag ttattgacat ttgaccacgc agagtcaagc atgccttgta tctgaggcaa    289740
     ttgataagtt cttacctttg acccagtact gaaatttgta ctgtactgac atttatagaa    289800
     tacaacatgg atccgcaagc cagaaggtgc ctgtggaaga tatttttcac accaaatcca    289860
     ctttgcaacc agccagccga tcgaagagac atgacttagg ctgactggtc caaacgtcta    289920
     tgcgaagatg tctgatgtct ctccgcccca gccgactgag ctgatctact gtacagcccc    289980
     tgtgcgtatt cccaaggcaa aagcgcgaat atccacgtcg caggtatgtg aatcttattc    290040
     tgacctgtct ggagttccac tgatcctgaa gtcgatgcga ttccaataga accgaggaca    290100
     ttcgaccaca acgcacgagc gcaaggacca caactctttg ccgtctcttc ctccctagtt    290160
     ttgaccacct gaacatgtaa gtcacggagt aacttactga tctacaagct aatgcatgac    290220
     agtgaaccat tgacatcgca cgagagtggc cccgaggata cggcagcccg ttgctgctgt    290280
     ataaagccat ggcttataca ccagaccttg tccagtcgct tcataccaca cagcataccc    290340
     taggtatagt atataactcg aaggagcggg ccaacaacag ggtgtgaaca tccgattgcg    290400
     aaattcgcca cacagaacgt ccattcttcc tggtaaggta agtgatatat cgcgccttct    290460
     gctgcgctat atccagttat ttgngcaagt ttttgtgccc caaatcatga ncgccattac    290520
     tgatcttcat gctattgtat ataggaaccg cccatcgccg cccgtgaaac acccttgtgc    290580
     ggagtcctat caccgaatcg gactacgacg cgtgctccgc gtcttctgcc tcgatctcac    290640
     cgccttcata ccatgatcgg cgaagtgtat gaacctctgg ccgtccgcat cgcgaggtct    290700
     tatcccatta cgactgtaca atttattatc acanatgggt tcgtcacgtg cctttggctc    290760
     tcacaagttg cccggtgcgt ccagcgtggc ttctccgaag cgacagccgg agattgcgac    290820
     gatctggata caacatcatg tcaacatggc atgaatggtg accacatcga tgaagacaat    290880
     tgtaagtgac cttgtaggta agataatatg atcaccaagc taattgatcg tctccttcca    290940
     agcaaacata ctgcgatctt tatgaactgg taagtgataa caacttgtcc cagtggttca    291000
     agccttgctg actcggatcg tacaatagga ggtgccctct tggtctcgtc actcgagtcg    291060
     gattgaagcg cgcaagtgca ttgtctgctc ggantccccg atcccgatgc gattccatgc    291120
     tctatcgccc gacatgacca ttggtggcat cgatgatgag ccaatgtaaa gttctgatcg    291180
     cctttacctt cgcccttctc tctcagtcga ctctgtatat caggtcatgt gctgatgcgt    291240
     ctacgcgata catacgccaa attccaatgg cttataccac ctgtgtcttt cggcattcga    291300
     acaccgtgaa agaatagtga aagaataacc ctcgtgaatt ggattactgg cgtccaatgg    291360
     gtggccccac gttgttatcg gatggcatcc ggcgtctttt caagcctgat tatccgacag    291420
     gcaccgagaa atgccgatgt ctcgcgttgc ttaatggcag gggagcctac cttcactatt    291480
     ggccatgttg ttagtccaaa gccgcgtgca aggagaaggc gaggcaaaac tcccttcgtt    291540
     tctgacctag gggctaattt cggtcatact agctaccaac cgagaagaca agaccgttac    291600
     cgaggcacag cccagccagc taaagagcca gaaataccat ccgataccgt cccatctcct    291660
     actccgcatt gctcaggtgt tcgatgtata cgtaagagcg gaaacgaacc aagcggaaat    291720
     atacggagct gcatcaagta ggtgtcagaa atgtctcttt ggaacaggtg tttggtatat    291780
     ttggatccca agcacccatt tctctatcaa accccaagaa atacccagaa agtcgcatat    291840
     gtcctggatg ccactgaaac tgcaggacag tcaagccggc cgcgtgtctc tgtctattga    291900
     tgtcgttttc taacctatcg cgcgcaagca gctcctgcca gggactcgtc ggtttctgta    291960
     cacccagcat cgactattca gcattaagta tatatttgtc aaactcaccg cggcctggat    292020
     gacatttagc atatcgctgt tcaagcagat cctttgtgaa tatgagt                  292067
//

If you have problems or comments...

PBIL Back to PBIL home page